Overview

  • Product name

    Anti-SLF2 antibody
  • Description

    Rabbit polyclonal to SLF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SLF2 aa 316-399 (internal sequence).
    Sequence:

    SSDSWEPTSAGSKQNKFPEKRKRNSVDSDLKSTRESMIPKARESFLEKRP DGPHQKEKFIKHIALKTPGDVLRLEDISKEPSDE

  • Positive control

    • Human cerebellum tissue.
  • General notes

     This product was previously labelled as FAM178A

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • Tissue specificity

    Widely expressed. Expressed at higher level in skeletal muscle and at slightly lower level in brain, liver and heart, than in lung, kidney, spleen and thymus.
  • Sequence similarities

    Belongs to the FAM178 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • C10orf6 antibody
    • F178A_HUMAN antibody
    • Fam178a antibody
    • Family with sequence similarity 178, member A antibody
    • Protein FAM178A antibody
    see all

Images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in plasma membrane, cytoplasm and golgi apparatus. Recommended concentration of ab122480 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122480 at 1/500 dilution staining SLF2 in paraffin-embedded Human cerebellum tissue by Immunohistochemistry.

References

ab122480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
100000 cells
Specification
HeLa cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jun 29 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up