Anti-SLF2 antibody (ab122480)
Key features and details
- Rabbit polyclonal to SLF2
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLF2 antibody -
Description
Rabbit polyclonal to SLF2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human SLF2 aa 316-399 (internal sequence).
Sequence:SSDSWEPTSAGSKQNKFPEKRKRNSVDSDLKSTRESMIPKARESFLEKRP DGPHQKEKFIKHIALKTPGDVLRLEDISKEPSDE
-
Positive control
- Human cerebellum tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122480 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
Use a concentration of 1 - 4 µg/ml.
Recommend PFA Fixation and Triton X-100 treatment |
Notes |
---|
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
Target
-
Tissue specificity
Widely expressed. Expressed at higher level in skeletal muscle and at slightly lower level in brain, liver and heart, than in lung, kidney, spleen and thymus. -
Sequence similarities
Belongs to the FAM178 family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. - Information by UniProt
-
Database links
- Entrez Gene: 55719 Human
- Omim: 610348 Human
- SwissProt: Q8IX21 Human
- Unigene: 447458 Human
-
Alternative names
- C10orf6 antibody
- F178A_HUMAN antibody
- Fam178a antibody
see all
Images
-
Immunofluorescent staining of Human cell line A-431 shows positivity in plasma membrane, cytoplasm and golgi apparatus. Recommended concentration of ab122480 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
ab122480 at 1/500 dilution staining SLF2 in paraffin-embedded Human cerebellum tissue by Immunohistochemistry.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab122480 has been referenced in 1 publication.
- Dupont L et al. The SMC5/6 complex compacts and silences unintegrated HIV-1 DNA and is antagonized by Vpr. Cell Host Microbe 29:792-805.e6 (2021). PubMed: 33811831