Overview

  • Product name

    Anti-Slit3 antibody - N-terminal
    See all Slit3 primary antibodies
  • Description

    Rabbit polyclonal to Slit3 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Slit3 aa 226-275 (N terminal). The exact sequence is proprietary.
    Sequence:

    LSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNA


    Database link: O75094-2

  • Positive control

    • HepG2 whole cell lysate (ab7900).

Properties

Applications

Our Abpromise guarantee covers the use of ab186706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 157 kDa.

Target

  • Function

    May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
  • Tissue specificity

    Predominantly expressed in thyroid.
  • Sequence similarities

    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 9 EGF-like domains.
    Contains 1 laminin G-like domain.
    Contains 20 LRR (leucine-rich) repeats.
    Contains 4 LRRCT domains.
    Contains 4 LRRNT domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10764 antibody
    • KIAA0814 antibody
    • MEGF 5 antibody
    • MEGF5 antibody
    • Multiple EGF-like domains protein 5 antibody
    • Multiple epidermal growth factor like domains 5 antibody
    • Multiple epidermal growth factor-like domains protein 5 antibody
    • SLIL 2 antibody
    • SLIL2 antibody
    • SLIT 1 antibody
    • Slit 2 antibody
    • Slit 3 antibody
    • Slit homolog 3 (Drosophila) antibody
    • Slit homolog 3 antibody
    • Slit homolog 3 protein antibody
    • Slit-3 antibody
    • SLIT1 antibody
    • Slit2 antibody
    • Slit3 antibody
    • SLIT3_HUMAN antibody
    see all

Images

  • Anti-Slit3 antibody - N-terminal (ab186706) at 1 µg/ml + HepG2 whole cell lysates at 10 µg

    Predicted band size: 157 kDa

References

ab186706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up