Overview

  • Product name

  • Description

    Rabbit polyclonal to Slitrk1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Slitrk1 aa 20-70 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    TGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNS L


    Database link: Q96PX8

  • Positive control

    • Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Relevance

    Slitrk1 is a member of a protein family consisting of six homologous transmembrane proteins (Slitrk1-6) that share two conserved leucine-rich repeat domains in the extracellular domain and have significant homology to Slit, a secreted axonal growth-controlling protein. These proteins are also homologous to trk neurotrophin receptors in their intracellular domains. Expression of Slitrk proteins is highly restricted to neural and brain tumor tissues, but varies within the family. For example, Slitrk1 is expressed primarily in mature neurons. Overexpression of Slitrk1 in transfected neuronal cells induced unipolar neurites, while expression of the other Slitrk proteins inhibited neurite outgrowth, suggesting that these proteins are involved in the control of neurite outgrowth. While Slitrk1 variants have been suggested associated with Tourette’s Syndrome, it is thought to play only a minor role if at all.
  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • SLITRK1 antibody
    • FLJ54428 antibody
    • KIAA0918 antibody
    • KIAA1910 antibody
    • Leucine rich repeat containing protein 12 antibody
    • LRRC1 antibody
    • LRRC12 antibody
    • RP11-395N17.1 antibody
    • SLIT and NTRK like family, member 1 antibody
    • SLIT and NTRK-like protein 1 antibody
    • slit and trk like gene 1 antibody
    • SLITRK 1 antibody
    • TTM antibody
    • UNQ233/PRO266 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Slitrk1 with ab217751 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up