Overview

  • Product name

    Anti-SLMAP antibody
  • Description

    Rabbit polyclonal to SLMAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human SLMAP aa 41-116.
    Sequence:

    TTDAQMDEQDLNEPLAKVSLLKALLEEERKAYRNQVEESTKQIQVLQAQL QRLHIDTENLREEKDSEITSTRDELL


    Database link: H7BZW9

  • Positive control

    • IHC-P: Human smooth muscle and testis tissue. WB: U-251 MG, NIH/3T3, NBT-II, RT4 and A431 cell lysate. Human tonsil lysate. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB Use a concentration of 0.4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Multiple SLMAP (Sarcolemmal-membrane-associated protein) mRNAs are generated by alternative splicing mechanisms. These isoforms have unique COOH-terminal membrane anchors that target SLMAP to distinct subcellular membranes. Regulated levels and the temporal induction of SLMAP isoforms are important for normal muscle development.
  • Cellular localization

    Cell membrane, sarcolemma; Single-pass type IV membrane protein. Note=Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule-dependent manner
  • Database links

  • Alternative names

    • FLJ42206 antibody
    • KIAA1601 antibody
    • MGC138760 antibody
    • MGC138761 antibody
    • Sarcolemma associated protein antibody
    • Sarcolemmal associated protein antibody
    • Sarcolemmal membrane associated protein antibody
    • SLAP antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of A431 (Human epidermoid carcinoma cell line) cells labeling SLMAP using ab243383 at 4 µg/ml (green). Nuclear probe is visualized in blue, microtubules in red.

  • Formalin-fixed, paraffin-embedded human testis tissue stained for SLMAP with ab243383 at a 1:200 dilution in immunohistochemical analysis.

  • All lanes : Anti-SLMAP antibody (ab243383) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat Wistar bladder tumor cell line) cell lysate
  • All lanes : Anti-SLMAP antibody (ab243383) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : A431 (Human epidermoid carcinoma cell line) cell lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate
  • Formalin-fixed, paraffin-embedded human smooth muscle tissue stained for SLMAP with ab243383 at a 1:200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human lymph node tissue stained for SLMAP with ab243383 at a 1:200 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for SLMAP with ab243383 at a 1:200 dilution in immunohistochemical analysis.

References

ab243383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up