Anti-Sly1 antibody (ab86594)
Key features and details
- Rabbit polyclonal to Sly1
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Sly1 antibody -
Description
Rabbit polyclonal to Sly1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan, Elephant -
Immunogen
Synthetic peptide corresponding to Human Sly1 aa 300-350 (internal sequence).
Sequence:VENSPAGARPKRKNKKSYDLTPVDKFWQKHKGSPFPEVAESVQQELESYR A
Database link: NP_057190.2 -
Positive control
- Whole cell lysate from HeLa cells, 293T cells or NIH3T3 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab86594 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 72 kDa.
|
|
IP |
Use at 2-5 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 72 kDa. |
IP
Use at 2-5 µg/mg of lysate. |
Target
-
Function
Plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. Involved in vesicular transport between the endoplasmic reticulum and the Golgi. -
Sequence similarities
Belongs to the STXBP/unc-18/SEC1 family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane. - Information by UniProt
-
Database links
- Entrez Gene: 100140328 Cow
- Entrez Gene: 480281 Dog
- Entrez Gene: 23256 Human
- Entrez Gene: 76983 Mouse
- Entrez Gene: 54350 Rat
- SwissProt: Q8WVM8 Human
- SwissProt: Q8BRF7 Mouse
- SwissProt: Q62991 Rat
see all -
Alternative names
- C14orf163 antibody
- Chromosome 14 open reading frame 163 antibody
- RA410 antibody
see all
Images
-
All lanes : Anti-Sly1 antibody (ab86594) at 0.04 µg/ml
Lane 1 : Whole cell lysate from HeLa cells at 50 µg
Lane 2 : Whole cell lysate from HeLa cells at 15 µg
Lane 3 : Whole cell lysate from HeLa cells at 5 µg
Lane 4 : Whole cell lysate from 293T cells at 50 µg
Lane 5 : Whole cell lysate from NIH3T3 cells at 50 µg
Predicted band size: 72 kDa
Exposure time: 3 minutes -
1mg whole cell lysate from Hela cells was immunoprecipited using 3ug ab86594. 20% of IP was loaded per lane, and probed with ab86549 at 1ug/ml (lane 1) or with a control IgG (lane 2).
Detection: chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab86594 has not yet been referenced specifically in any publications.