Overview

  • Product name

  • Description

    Rabbit polyclonal to Sly1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan, Elephant
  • Immunogen

    Synthetic peptide corresponding to Human Sly1 aa 300-350 (internal sequence).
    Sequence:

    VENSPAGARPKRKNKKSYDLTPVDKFWQKHKGSPFPEVAESVQQELESYR A


    Database link: NP_057190.2

  • Positive control

    • Whole cell lysate from HeLa cells, 293T cells or NIH3T3 cells.
  • General notes

    Previously labelled as SCFD1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab86594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 72 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function

    Plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. Involved in vesicular transport between the endoplasmic reticulum and the Golgi.
  • Sequence similarities

    Belongs to the STXBP/unc-18/SEC1 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C14orf163 antibody
    • Chromosome 14 open reading frame 163 antibody
    • RA410 antibody
    • Scfd1 antibody
    • SCFD1_HUMAN antibody
    • Sec1 family domain containing 1 antibody
    • Sec1 family domain-containing protein 1 antibody
    • SLY1 antibody
    • SLY1 homolog antibody
    • Sly1p antibody
    • STXBP1L2 antibody
    • Syntaxin binding protein 1 like 2 antibody
    • Syntaxin-binding protein 1-like 2 antibody
    • Vesicle transport related protein antibody
    see all

Images

  • All lanes : Anti-Sly1 antibody (ab86594) at 0.04 µg/ml

    Lane 1 : Whole cell lysate from HeLa cells at 50 µg
    Lane 2 : Whole cell lysate from HeLa cells at 15 µg
    Lane 3 : Whole cell lysate from HeLa cells at 5 µg
    Lane 4 : Whole cell lysate from 293T cells at 50 µg
    Lane 5 : Whole cell lysate from NIH3T3 cells at 50 µg

    Predicted band size: 72 kDa


    Exposure time: 3 minutes
  • 1mg whole cell lysate from Hela cells was immunoprecipited using 3ug ab86594. 20% of IP was loaded per lane, and probed with ab86549 at 1ug/ml (lane 1) or with a control IgG (lane 2).
    Detection: chemiluminescence with an exposure time of 30 seconds.

References

ab86594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up