Overview

  • Product name
  • Description
    Rabbit polyclonal to Sm-D1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human Sm-D1 aa 38-70. The exact sequence is proprietary.
    Sequence:

    THLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

  • Positive control
    • Jurkat cell lysate and human kidney tissue.
  • General notes

    Protein previously labeled as SNRPD1.

Properties

Applications

Our Abpromise guarantee covers the use of ab50940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 13 kDa (predicted molecular weight: 13 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function
    May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.
  • Sequence similarities
    Belongs to the snRNP core protein family.
  • Post-translational
    modifications
    Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AA407109 antibody
    • AL023031 antibody
    • HsT2456 antibody
    • Sm D1 antibody
    • Sm-D autoantigen antibody
    • Sm-D1 antibody
    • Small nuclear ribonucleoprotein D1 polypeptide antibody
    • Small nuclear ribonucleoprotein Sm D1 antibody
    • SmD autoantigen antibody
    • SMD1 antibody
    • SMD1_HUMAN antibody
    • snRNP core protein D1 antibody
    • SNRPD antibody
    • Snrpd1 antibody
    see all

Images

  • Anti-Sm-D1 antibody (ab50940) at 0.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa
    Observed band size: 13 kDa

  • ab50940 at 4ug/ml staining human Sm-D1 in epithelial cells of renal tubule in human kidney by Immunohistochemistry, Paraffin embedded tissue.

References

ab50940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab50940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up