Overview

  • Product name

    Anti-Smac / Diablo antibody
    See all Smac / Diablo primary antibodies
  • Description

    Rabbit polyclonal to Smac / Diablo
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Smac/ Diablo aa 1-232. (NP_063940.1).
    Sequence:

    MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGF GVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAI TEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEY LKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQL SRKAETKLAEAQIEELRQKTQEEGEERAESEQ


    Database link: Q9NR28-1

  • Positive control

    • WB: SW620 and BT-474 cell lysates; Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab238525 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

Target

  • Function

    Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP).
  • Tissue specificity

    Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes.
  • Domain

    The mature N-terminus mediates interaction with XIAP.
  • Cellular localization

    Mitochondrion. Released into the cytosol when cells undergo apoptosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610041G12Rik antibody
    • DBLOH_HUMAN antibody
    • DBOH antibody
    • DFNA64 antibody
    • diablo antibody
    • Diablo homolog (Drosophila) antibody
    • Diablo homolog antibody
    • Diablo homolog mitochondrial antibody
    • Diablo IAP binding mitochondrial protein antibody
    • Diablo like protein antibody
    • DIABLO S antibody
    • Direct IAP binding protein with low pI antibody
    • Direct IAP-binding protein with low pI antibody
    • FLJ10537 antibody
    • FLJ25049 antibody
    • mitochondrial antibody
    • Mitochondrial Smac protein antibody
    • Second mitochondria derived activator of caspase antibody
    • Second mitochondria-derived activator of caspase antibody
    • SMAC 3 antibody
    • Smac antibody
    • Smac protein antibody
    • SMAC3 antibody
    see all

Images

  • All lanes : Anti-Smac/Diablo antibody (ab238525) at 1/1000 dilution

    Lane 1 : SW620 cell lysate
    Lane 2 : BT-474 (human ductal breast epithelial tumor cell line) cell lysate
    Lane 3 : Mouse spleen lysate

    Predicted band size: 27 kDa

References

ab238525 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238525.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up