Overview

  • Product name

    Anti-smAKAP antibody
  • Description

    Rabbit polyclonal to smAKAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human smAKAP aa 1-73.
    Sequence:

    MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKE PPGTNTVILEYAHRLSQDILCDA

  • Positive control

    • Human kidney tissue.
  • General notes

    The antibody solution should be gently mixed before use.

    Previously labelled as C2orf88.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab151068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.
  • Tissue specificity

    Expressed in heart (at protein level).
  • Sequence similarities

    Belongs to the small membrane AKAP family.
  • Post-translational
    modifications

    May be palmitoylated at Cys-3.
  • Cellular localization

    Cell membrane. The GFP-tagged protein has been detected at the plasma membrane, enriched in filopodia and cell-cell junctions.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2orf88 antibody
    • Chromosome 2 open reading frame 88 antibody
    • MGC13057 antibody
    • SMAKA_HUMAN antibody
    • smAKAP antibody
    • Small membrane A-kinase anchor protein antibody
    • Small membrane AKAP antibody
    • Uncharacterized protein FLJ90687 antibody
    • UPF0733 protein C2orf88 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling smAKAP with ab151068 at 1/500 dilution.

References

ab151068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up