Overview

  • Product name

    Anti-SMARCA2 / BRM antibody
    See all SMARCA2 / BRM primary antibodies
  • Description

    Rabbit polyclonal to SMARCA2 / BRM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SMARCA2/ BRM aa 175-281.
    Sequence:

    SPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQ QQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPST PQKLPVP


    Database link: P51531

  • Positive control

    • ICC/IF/ U-2 OS cells. IHC-P: Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Transcriptional coactivator cooperating with nuclear hormone receptors to potentiate transcriptional activation. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
  • Involvement in disease

    Nicolaides-Baraitser syndrome
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 bromo domain.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 HSA domain.
    Contains 1 QLQ domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP dependent helicase SMARCA2 antibody
    • ATP-dependent helicase SMARCA2 antibody
    • BAF190 antibody
    • BAF190B antibody
    • BRG1-associated factor 190B antibody
    • BRM antibody
    • FLJ36757 antibody
    • Global transcription activator homologous sequence antibody
    • hBRM antibody
    • hSNF2a antibody
    • MGC74511 antibody
    • Possible global transcription activator SNF2L2 antibody
    • Probable global transcription activator SNF2L2 antibody
    • Protein brahma homolog antibody
    • SMARCA2 antibody
    • SMCA2_HUMAN antibody
    • SNF2 alpha antibody
    • SNF2 like 2 antibody
    • SNF2-alpha antibody
    • SNF2/SWI2 like protein 2 antibody
    • SNF2L2 antibody
    • SNF2LA antibody
    • Sth1p antibody
    • Sucrose nonfermenting 2 like protein 2 antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 2 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for SMARCA2 / BRM (green) using ab223735 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human cerebral cortex tissue stained for SMARCA2 / BRM with ab223735 (1/200 dilution) in immunohistochemical analysis.

References

ab223735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up