Overview

  • Product name

  • Description

    Rabbit polyclonal to SmarcAL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SmarcAL1 aa 6-277.
    Sequence:

    TEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQ NFPRESCKPVSHGVIFKQQNLSSSSNADQRPHDSHSFQAKGIWKKPEEMP TACPGHSPRSQMALTGISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIR FTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNIS YIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYN AELIAVFKTLPSKNYDPDTKTW


    Database link: Q9NZC9

  • Positive control

    • WB: Jurkat whole cell lysate; Mouse lung and kidney tissue lysate. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    ATP-dependent annealing helicase that catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA.
  • Tissue specificity

    Ubiquitously expressed, with high levels in testis.
  • Involvement in disease

    Defects in SMARCAL1 are a cause of Schimke immuno-osseous dysplasia (SIOD) [MIM:242900]. SIOD causes spondyloepiphyseal dysplasia, renal dysfunction and T-cell immunodeficiency. Approximately half of all patients also exhibit hyperthyroidism, while around half also exhibit episodal cerebral ischema.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family. SMARCAL1 subfamily.
    Contains 2 HARP domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HARP antibody
    • HepA Related Protein antibody
    • HepA-related protein antibody
    • hHARP antibody
    • SIOD antibody
    • SMAL1_HUMAN antibody
    • SMARCA like Protein 1 antibody
    • smarcal1 antibody
    • Sucrose nonfermenting protein 2 like 1 antibody
    • Sucrose nonfermenting protein 2-like 1 antibody
    • SWI/SNF Related antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A like protein 1 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 antibody
    see all

Images

  • All lanes : Anti-SmarcAL1 antibody (ab236786) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SmarcAL1 (green) using ab236786 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up