Overview

  • Product name

  • Description

    Rabbit polyclonal to SMARCD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SMARCD1 aa 40-125.
    Sequence:

    MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRP GLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK


    Database link: Q96GM5

  • Positive control

    • WB: NIH/3T3, NBT-II, RT4 and U-251 MG sp cell lysates. IHC-P: Humantestis tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 58 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Involved in chromatin remodeling. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity). Has a strong influence on the Vitamin D-mediated transcriptional activity from an enhancer Vitamin D receptor element (VDRE). May be a link between mammalian SWI-SNF-like chromatin remodeling complexes and the vitamin D receptor (VDR) heterodimer. Mediates critical interactions between nuclear receptors and the BRG1/SMARCA4 chromatin-remodeling complex for transactivation. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
  • Tissue specificity

    Expressed in all tissues tested, including brain, heart, kidney, liver, lung, muscle, pancreas and placenta.
  • Sequence similarities

    Belongs to the SMARCD family.
    Contains 1 SWIB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa BRG-1/Brm-associated factor subunit A antibody
    • 60 kDa BRG1/Brm associated factor subunit A antibody
    • BAF60A antibody
    • BRG1 associated factor 60A antibody
    • BRG1-associated factor 60A antibody
    • Chromatin remodeling complex BAF60A subunit antibody
    • CRACD1 antibody
    • Mammalian chromatin remodeling complex BRG1 associated factor 60A antibody
    • Rsc6p antibody
    • SMARCD1 antibody
    • SMRD1 antibody
    • SMRD1_HUMAN antibody
    • SWI/SNF complex 60 kDa subunit A antibody
    • SWI/SNF complex 60 kDa subunit antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin d1 antibody
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 antibody
    • Swp73 like protein antibody
    see all

Images

  • All lanes : Anti-SMARCD1 antibody (ab224229) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Predicted band size: 58 kDa

  • Paraffin-embedded human testis tissue stained for SMARCD1 with ab224229 (1/50) in immunohistochemical analysis.

  • All lanes : Anti-SMARCD1 antibody (ab224229) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate

    Predicted band size: 58 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SMARCD1 (green) using ab224229 (4 µg/ml) in ICC/IF.

References

ab224229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up