Overview

  • Product name

  • Description

    Rabbit polyclonal to SMARCD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human SMARCD2 aa 70-131.
    Sequence:

    QYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRL LVPQAQPPMPAQ


    Database link: Q92925

  • Positive control

    • MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    SMARCD2 is a member of the SWI/SNF family of proteins which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 60 kDa BRG 1/Brm associated factor subunit B antibody
    • 60 kDa BRG1/Brm associated factor subunit B antibody
    • BAF60B antibody
    • BRG1 associated factor 60B antibody
    • Chromatin remodeling complex BAF60B subunit antibody
    • CRACD 2 antibody
    • CRACD2 antibody
    • Mammalian chromatin remodeling complex BRG1 associated factor 60B antibody
    • PRO2451 antibody
    • Rsc6p antibody
    • SMARCD 2 antibody
    • SWI/SNF complex 60 kDa subunit B antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin d2 antibody
    • SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily d member 2 antibody
    • Swp73 like protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized MCF7 cells labeling SMARCD2 with ab221168 at 4 μg/ml (green).

References

ab221168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up