Overview

  • Product name

  • Description

    Rabbit polyclonal to SMC5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SMC5 aa 27-138.
    Sequence:

    EVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLN MIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIE LFRASGNLVITR


    Database link: Q8IY18

  • Positive control

    • Human RT4 cell lysate; Human prostate tissue; HeLa cells

Properties

Applications

Our Abpromise guarantee covers the use of ab185373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Relevance

    Structural Maintenance of Chromosomes (SMC) family proteins play critical roles in various nuclear events that require structural changes of chromosomes, including mitotic chromosome organization, DNA recombination and repair and global transcriptional repression. The chromosome proteins are conserved in eukaryotes lead to mitotic chromosome segregation defects, suggesting a critical function of SMC family proteins in mitotic chromosome dynamics.
  • Cellular localization

    Nucleus. Chromosome. Chromosome; telomere. Note: Associates with chromatin. Localizes to PML nuclear bodies in ALT cell lines.
  • Database links

  • Alternative names

    • hSMC 5 antibody
    • hSMC5 antibody
    • KIAA0594 antibody
    • MLZ-453 antibody
    • OTTHUMP00000063367 antibody
    • SMC 5 antibody
    • SMC 5 structural maintenance of chromosomes 5 like 1 antibody
    • SMC protein 5 antibody
    • SMC5 L1 antibody
    • SMC5 protein antibody
    • SMC5 structural maintenance of chromosomes 5 like 1 antibody
    • SMC5L1 antibody
    • Structural maintenance of chromosomes 5 antibody
    • Structural maintenance of chromosomes 5 like 1 antibody
    • Structural maintenance of chromosomes protein 5 antibody
    see all

Images

  • Anti-SMC5 antibody (ab185373) at 1/250 dilution + Human RT4 cell lysate
  • Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling SMC5 using ab185373 at 1/200 dilution.

  • Immunofluorescence analysis of PFA/Triton X-100 permeabilized HeLa cells labeling SMC5 using ab185373 at 4 µg/ml.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up