Overview

  • Product name
  • Description
    Rabbit polyclonal to SMCHD1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human SMCHD1 aa 1955-2005. The exact sequence is proprietary. (NP_056110.2).
    Sequence:

    IEEKLGMTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTD V


    Database link: A6NHR9

  • Positive control
    • HeLa and 293T cell lysates; Human non-small cell lung cancer and testicular seminoma tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 0.1% BSA, 99% Tris buffered saline
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176731 is affinity purified using an epitope specific to SMCHD1 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 226 kDa.
IP Use at 2-5 µg/mg of lysate.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/250.

Target

  • Information by UniProt
  • Database links
  • Alternative names
    • BAMS antibody
    • FSHD2 antibody
    • KIAA0650 antibody
    • SMC hinge domain containing 1 antibody
    • SMC hinge domain containing protein 1 antibody
    • Smchd1 antibody
    • SMHD1_HUMAN antibody
    • Structural maintenance of chromosomes flexible hinge domain containing 1 antibody
    • Structural maintenance of chromosomes flexible hinge domain-containing protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testicular seminoma tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human non-small cell lung cancer tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.

  • Detection of SMCHD1 in Immunoprecipitaties of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded), using ab176731 at 3 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection.

    Detection: Chemiluminescence with exposure time of 3 seconds.

  • All lanes : Anti-SMCHD1 antibody (ab176731) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 226 kDa


    Exposure time: 3 minutes

References

ab176731 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up