Anti-SMCHD1 antibody (ab176731)
Key features and details
- Rabbit polyclonal to SMCHD1
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SMCHD1 antibody
See all SMCHD1 primary antibodies -
Description
Rabbit polyclonal to SMCHD1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla -
Immunogen
Synthetic peptide within Human SMCHD1 aa 1955-2005. The exact sequence is proprietary. (NP_056110.2).
Sequence:IEEKLGMTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTD V
Database link: A6NHR9 -
Positive control
- HeLa and 293T cell lysates; Human non-small cell lung cancer and testicular seminoma tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176731 is affinity purified using an epitope specific to SMCHD1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176731 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 226 kDa.
|
|
IP |
Use at 2-5 µg/mg of lysate.
|
|
IHC-P |
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 226 kDa. |
IP
Use at 2-5 µg/mg of lysate. |
IHC-P
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 23347 Human
- Omim: 614982 Human
- SwissProt: A6NHR9 Human
- Unigene: 8118 Human
-
Alternative names
- BAMS antibody
- FSHD2 antibody
- KIAA0650 antibody
see all
Images
-
All lanes : Anti-SMCHD1 antibody (ab176731) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 226 kDa
Exposure time: 3 minutes -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMCHD1 antibody (ab176731)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testicular seminoma tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMCHD1 antibody (ab176731)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human non-small cell lung cancer tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.
-
Detection of SMCHD1 in Immunoprecipitaties of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded), using ab176731 at 3 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection.
Detection: Chemiluminescence with exposure time of 3 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab176731 has been referenced in 1 publication.
- Balog J et al. Monosomy 18p is a risk factor for facioscapulohumeral dystrophy. J Med Genet 55:469-478 (2018). PubMed: 29563141