Overview

  • Product name

    Anti-SMCHD1 antibody [CL4265]
    See all SMCHD1 primary antibodies
  • Description

    Mouse monoclonal [CL4265] to SMCHD1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SMCHD1 aa 184-271.
    Sequence:

    DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDIS YFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED


    Database link: A6NHR9

  • Positive control

    • Human fallopian tube, endometrium, breast cancer and stomach tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4265
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded human fallopian tube tissue labeling SMCHD1 with ab220026 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue labeling SMCHD1 with ab220026 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human breast cancer tissue labeling SMCHD1 with ab220026 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human stomach tissue labeling SMCHD1 with ab220026 at 1/500 dilution.

References

ab220026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up