Overview

  • Product name

    Anti-SMCP antibody
  • Description

    Rabbit polyclonal to SMCP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SMCP aa 6-93.
    Sequence:

    KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKH NHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ


    Database link: P49901

  • Positive control

    • IHC-P: Human testis tissue. WB: SMCP overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 13 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida.
  • Tissue specificity

    Testis. Is selectively expressed in the spermatids of seminiferous tubules.
  • Developmental stage

    Expressed in postmeiotic cells.
  • Cellular localization

    Cytoplasm. Mitochondrion membrane. Becomes associated with the spermatid mitochondrion capsule at step 16 of spermatogenesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSMCSGEN1 antibody
    • MCS antibody
    • MCSP antibody
    • MCSP_HUMAN antibody
    • Mitochondrial capsule selenoprotein antibody
    • SMCP antibody
    • Sperm mitochondria associated cysteine rich protein antibody
    • Sperm mitochondrial-associated cysteine-rich protein antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for SMCP using ab224494 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-SMCP antibody (ab224494) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : SMCP overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 13 kDa

References

ab224494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up