Overview

  • Product name

  • Description

    Rabbit polyclonal to Smek1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Smek1 aa 641-691.
    Sequence:

    KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDM E


    Database link: Q6IN85

  • Positive control

    • RT-4 cell lysate; MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 95 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Regulatory subunit of serine/threonine-protein phosphatase 4. May regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.
  • Sequence similarities

    Belongs to the SMEK family.
    Contains 1 WH1 domain.
  • Cellular localization

    Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. In interphase localized in the cytoplasm and in the nucleus (with higher levels). During metaphase located in pericentriolar regions.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLFL1 antibody
    • KIAA2010 antibody
    • MEK1 SUPPRESSOR 1 antibody
    • MSTP033 antibody
    • P4R3A_HUMAN antibody
    • PP4R3 ALPHA antibody
    • PP4R3 antibody
    • PP4R3A antibody
    • PPP4R3A antibody
    • Protein phosphatase 4 regulatory subunit 3A antibody
    • PROTEIN PHOSPHATASE 4, REGULATORY SUBUNIT 3, ALPHA antibody
    • Serine/threonine-protein phosphatase 4 regulatory subunit 3A antibody
    • SMEK homolog 1 antibody
    • SMEK homolog 1, suppressor of mek1 (Dictyostelium) antibody
    • smek1 antibody
    • Smk 1 antibody
    • SMK1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling Smek1 with ab221392 at 4 µg/ml (green).

  • Anti-Smek1 antibody (ab221392) at 1/250 dilution + RT-4 cell lysate

    Predicted band size: 95 kDa

References

ab221392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up