Overview

  • Product name

  • Description

    Rabbit polyclonal to SMEK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human SMEK2 aa 670-733. aa729-732 are modified.
    Sequence:

    GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFN EDEEEEGKAVMPPLE


    Database link: Q5MIZ7

  • Positive control

    • WB: NIH/3T3, NBT-II, RT4, EFO-21 and A431 cell lysates. ICC/IF: U-251 MG cells. IHC-P: Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224222 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 97 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    SMEK2 contains a WH1 domain. There are five named isoforms produced by alternative splicing. Mapping of a diet-induced hypercholesterolemia locus (Dihc2) in rats identified SMEK2 as a strong candidate for responsiveness to dietary cholesterol.
  • Cellular localization

    Cytoplasm. Cytoskeleton. Centrosome. Nucleus. Note: In interphase localized in the cytoplasm and (with higher levels) the nucleus. During metaphase located in pericentriolar regions.
  • Database links

  • Alternative names

    • FLFL2 antibody
    • FLJ31474 antibody
    • KIAA1387 antibody
    • PP4R3 beta antibody
    • PP4R3B antibody
    • PPP4R3 Beta antibody
    • PPP4R3B antibody
    • Protein Phosphatase 4, Regulatory Subunit 3 Beta, antibody
    • PSY2 antibody
    • Serine/threonine-protein phosphatase 4 regulatory subunit 3B antibody
    • SMEK 2 antibody
    • SMEK homolog 2 antibody
    • SMEK homolog 2 suppressor of mek1 (Dictyostelium) antibody
    • SMEK homolog 2 suppressor of mek1 antibody
    • smk1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for SMEK2 (green) using ab224222 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human cerebral cortex tissue stained for SMEK2 using ab224222 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-SMEK2 antibody (ab224222) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : EFO-21 cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 97 kDa

  • All lanes : Anti-SMEK2 antibody (ab224222) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 97 kDa

References

ab224222 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224222.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up