Anti-SMNDC1 antibody (ab238846)
Key features and details
- Rabbit polyclonal to SMNDC1
- Suitable for: IHC-P, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SMNDC1 antibody
See all SMNDC1 primary antibodies -
Description
Rabbit polyclonal to SMNDC1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human SMNDC1 aa 1-238.
Sequence:MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLL STQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEE NGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQR EYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFA SPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Database link: O75940 -
Positive control
- IHC-P: Human heart tissue. IP: HeLa whole cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238846 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. | |
IP | 1/200 - 1/2000. |
Target
-
Function
Necessary for spliceosome assembly. Overexpression causes apoptosis. -
Tissue specificity
Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas. -
Sequence similarities
Belongs to the SMN family.
Contains 1 Tudor domain. -
Cellular localization
Nucleus speckle. Nucleus > Cajal body. Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies. - Information by UniProt
-
Database links
- Entrez Gene: 520500 Cow
- Entrez Gene: 10285 Human
- Entrez Gene: 76479 Mouse
- Entrez Gene: 100173826 Orangutan
- Entrez Gene: 287768 Rat
- Omim: 603519 Human
- SwissProt: Q3T045 Cow
- SwissProt: O75940 Human
see all -
Alternative names
- 30 kDa splicing factor SMNrp antibody
- MGC106917 antibody
- MGC112663 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Rabbit Polyclonal to SMNDC1 (ab238846)
Paraffin-embedded human heart tissue stained for SMNDC1 using ab238846 at 1/100 dilution in immunohistochemical analysis.
-
SMNDC1 was immunoprecipitated from 0.5 mg HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate using ab238846 at 1/200 dilution.
Lane 1: Rabbit control IgG instead of ab238846 in HeLa whole cell lysate.
Lane 2: ab238846 IP in HeLa whole cell lysate.
Lane 3: HeLa whole cell lysate (10 μg, input).For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238846 has not yet been referenced specifically in any publications.