Anti-SMNDC1 antibody (ab238846)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SMNDC1 antibody
See all SMNDC1 primary antibodies -
Description
Rabbit polyclonal to SMNDC1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human SMNDC1 aa 1-238.
Sequence:MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLL STQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEE NGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQR EYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFA SPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Database link: O75940 -
Positive control
- IHC-P: Human heart tissue. IP: HeLa whole cell lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238846 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. | |
| IP | 1/200 - 1/2000. |
Target
-
Function
Necessary for spliceosome assembly. Overexpression causes apoptosis. -
Tissue specificity
Detected at intermediate levels in skeletal muscle, and at low levels in heart and pancreas. -
Sequence similarities
Belongs to the SMN family.
Contains 1 Tudor domain. -
Cellular localization
Nucleus speckle. Nucleus > Cajal body. Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies. - Information by UniProt
-
Database links
- Entrez Gene: 520500 Cow
- Entrez Gene: 10285 Human
- Entrez Gene: 76479 Mouse
- Entrez Gene: 100173826 Orangutan
- Entrez Gene: 287768 Rat
- Omim: 603519 Human
- SwissProt: Q3T045 Cow
- SwissProt: O75940 Human
see all -
Alternative names
- 30 kDa splicing factor SMNrp antibody
- MGC106917 antibody
- MGC112663 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Rabbit Polyclonal to SMNDC1 (ab238846)Paraffin-embedded human heart tissue stained for SMNDC1 using ab238846 at 1/100 dilution in immunohistochemical analysis.
-
Immunoprecipitation - Rabbit Polyclonal to SMNDC1 (ab238846)SMNDC1 was immunoprecipitated from 0.5 mg HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate using ab238846 at 1/200 dilution.
Lane 1: Rabbit control IgG instead of ab238846 in HeLa whole cell lysate.
Lane 2: ab238846 IP in HeLa whole cell lysate.
Lane 3: HeLa whole cell lysate (10 μg, input).For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
References
ab238846 has not yet been referenced specifically in any publications.
