Overview

  • Product name

  • Description

    Rabbit polyclonal to Smoothened
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human Smoothened aa 546-590.
    Sequence:

    RRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFS


    Database link: Q99835

  • Positive control

    • WB: Rat brain lysate. IHC-P: Rat brain tissue. ICC/IF: Rat brain section.

Properties

Applications

Our Abpromise guarantee covers the use of ab236465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000.
IHC-P 1/100 - 1/500.
IF 1/50 - 1/200.

IHC-P

Target

  • Function

    G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia.
  • Sequence similarities

    Belongs to the G-protein coupled receptor Fz/Smo family.
    Contains 1 FZ (frizzled) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Frizzled family member 11 antibody
    • FZD11 antibody
    • Gx antibody
    • Gx protein antibody
    • Protein Gx antibody
    • SMO antibody
    • SMO_HUMAN antibody
    • SMOH antibody
    • Smoothened frizzled family receptor antibody
    • Smoothened homolog (Drosophila) antibody
    • Smoothened homolog antibody
    • Smoothened homolog precursor (SMO) (Gx protein) antibody
    • Smoothened seven transmembrane spanning receptor antibody
    see all

Images

  • All lanes : Anti-Smoothened antibody (ab236465) at 1/200 dilution

    Lane 1 : Rat kidney lysate
    Lane 2 : Rat brain lysate
  • Formalin-fixed, paraffin-embedded rat brain tissue stained for Smoothened using ab236465 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for Smoothened using ab236465 at 1/200 dilution in ICC/IF. Secondary antibody was Cy3 conjugated goat anti-rabbit IgG.

References

ab236465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (RPE1)
Gel Running Conditions
Non-reduced Denaturing
Loading amount
30 µg
Treatment
RNAi for Smo
Specification
RPE1
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 18 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up