Anti-SMP30 antibody (ab233007)
Key features and details
- Rabbit polyclonal to SMP30
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SMP30 antibody
See all SMP30 primary antibodies -
Description
Rabbit polyclonal to SMP30 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human SMP30 aa 65-299. (Expressed in E.coli).
Sequence:QSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYF AGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKI FYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKL WVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCAR DGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Database link: Q15493 -
Positive control
- WB: Human lung lysate; Mouse liver lysate, Recombinant human SMP30 protein. IHC-P: Human liver, kidney, liver cancer and stomach tissue.
-
General notes
This product was previously labelled as Regucalcin
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233007 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 33 kDa. |
Target
-
Function
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. -
Sequence similarities
Belongs to the SMP-30/CGR1 family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 280910 Cow
- Entrez Gene: 102134335 Cynomolgus monkey
- Entrez Gene: 9104 Human
- Entrez Gene: 19733 Mouse
- Entrez Gene: 100174578 Orangutan
- Omim: 300212 Human
- SwissProt: Q3ZBB2 Cow
- SwissProt: Q9TTJ5 Cow
see all -
Alternative names
- Gluconolactonase antibody
- GNL antibody
- RC antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)
Formalin-fixed, paraffin-embedded human stomach tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)
Formalin-fixed, paraffin-embedded human liver cancer tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)
Formalin-fixed, paraffin-embedded human kidney tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)
Formalin-fixed, paraffin-embedded human liver tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-SMP30 antibody (ab233007) at 2 µg/ml + Mouse liver lysate
Predicted band size: 33 kDa -
Anti-SMP30 antibody (ab233007) at 2 µg/ml + Human lung lysate
Predicted band size: 33 kDa -
Anti-SMP30 antibody (ab233007) at 2 µg/ml + Recombinant human SMP30 protein
Predicted band size: 33 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab233007 has been referenced in 1 publication.
- Xiang M et al. P38-Mediated Cellular Senescence in Conjunctivochalasis Fibroblasts. Invest Ophthalmol Vis Sci 60:4643-4651 (2019). PubMed: 31682715