Anti-SMP30 antibody (ab233007)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SMP30 antibody
See all SMP30 primary antibodies -
Description
Rabbit polyclonal to SMP30 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow, Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human SMP30 aa 65-299. (Expressed in E.coli).
Sequence:QSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYF AGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKI FYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKL WVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCAR DGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Database link: Q15493 -
Positive control
- WB: Human lung lysate; Mouse liver lysate, Recombinant human SMP30 protein. IHC-P: Human liver, kidney, liver cancer and stomach tissue.
-
General notes
This product was previously labelled as Regucalcin
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233007 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 33 kDa. |
Target
-
Function
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. -
Sequence similarities
Belongs to the SMP-30/CGR1 family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 280910 Cow
- Entrez Gene: 102134335 Cynomolgus monkey
- Entrez Gene: 9104 Human
- Entrez Gene: 19733 Mouse
- Entrez Gene: 100174578 Orangutan
- Omim: 300212 Human
- SwissProt: Q3ZBB2 Cow
- SwissProt: Q9TTJ5 Cow
see all -
Alternative names
- Gluconolactonase antibody
- GNL antibody
- RC antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)Formalin-fixed, paraffin-embedded human stomach tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)Formalin-fixed, paraffin-embedded human liver cancer tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)Formalin-fixed, paraffin-embedded human kidney tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMP30 antibody (ab233007)Formalin-fixed, paraffin-embedded human liver tissue stained for SMP30 using ab233007 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-SMP30 antibody (ab233007)Anti-SMP30 antibody (ab233007) at 2 µg/ml + Mouse liver lysate
Predicted band size: 33 kDa -
Western blot - Anti-SMP30 antibody (ab233007)Anti-SMP30 antibody (ab233007) at 2 µg/ml + Human lung lysate
Predicted band size: 33 kDa -
Western blot - Anti-SMP30 antibody (ab233007)Anti-SMP30 antibody (ab233007) at 2 µg/ml + Recombinant human SMP30 protein
Predicted band size: 33 kDa
Datasheets and documents
References
ab233007 has not yet been referenced specifically in any publications.
