Overview

  • Product name
    Anti-SNAIL + SLUG antibody
    See all SNAIL + SLUG primary antibodies
  • Description
    Mouse polyclonal to SNAIL + SLUG
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant full length protein aa 1-264. Corresponding to Human SNAIL.
    Sequence:

    MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL NPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGS QPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQA RKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSL LHKHQESGCSGCPR


    Database link: NP_005976.2

  • Positive control
    • SNAIl transfected 293T cell lysate. HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab167609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Relevance
    Function: SNAIL is involved in the epithelial to mesenchymal transition (EMT) and formation and maintenance of embryonic mesoderm (By similarity). Binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. SLUG is a transcriptional repressor, involved in the generation and migration of neural crest cells. PTM: SNAIL is phosphorylated by GSK3B. Once phosphorylated, it becomes a target for BTRC ubiquitination. Ubiquitinated on Lys-98, Lys-137 and Lys-146 by FBXL14 and BTRC leading to degradation. BTRC-triggered ubiquitination requires previous GSK3B-mediated SNAI1 phosphorylation. Similarity: Both SNAIL and SLUG belong to the snail C2H2-type zinc-finger protein family. Tissue specificity: SNAIL is expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. SLUG is expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle.
  • Cellular localization
    Slug is generally nuclear, while Snail is known to be both cytoplasmic and nuclear. Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) snail is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.
  • Database links
  • Alternative names
    • dJ710H13.1 antibody
    • MGC10182 antibody
    • Neural crest transcription factor Slug antibody
    • Protein sna antibody
    • Protein snail homolog 1 antibody
    • Protein snail homolog 2 antibody
    • Protein snail homolog antibody
    • Slug homolog zinc finger protein antibody
    • Slug zinc finger protein antibody
    • SLUGH antibody
    • SLUGH 1 antibody
    • SLUGH1 antibody
    • SLUGH2 antibody
    • SNA antibody
    • Sna protein antibody
    • SNAH antibody
    • SNAI 2 antibody
    • snai1 antibody
    • SNAI1_HUMAN antibody
    • Snai2 antibody
    • SNAI2_HUMAN antibody
    • Snail 2 antibody
    • Snail homolog 1 (Drosophila) antibody
    • Snail homolog 2 antibody
    • Snail2 antibody
    • WS 2D antibody
    • WS2D antibody
    • Zinc finger protein SLUG antibody
    • Zinc finger protein SNAI1 antibody
    • Zinc finger protein SNAI2 antibody
    see all

Images

  • All lanes : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml

    Lane 1 : SNAIL transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG

    Predicted band size: 29 kDa

  • Immunofluorescent analysis of HeLa cells labeling SNAIL with ab167609 at 10 µg/ml.
  • Lane 1 : Monoclonal Mouse anti-GST at 1 µg
    Lanes 2 & 5 : Milk at 5 %
    Lane 3 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg
    Lane 4 : Monoclonal Mouse anti-GST at 1 µg/ml
    Lane 6 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml

    Lanes 1-3 : SNAIL-GST fusion protein
    Lanes 4-6 : SLUG-GST-fusion protein

    Lysates/proteins at 0.2 µg per lane.

    Secondary
    All lanes : HRP conjugated Goat anti-mouse at 1/5000 dilution

    Predicted band size: 29 kDa
    Additional bands at: 55.5 kDa (possible tagged protein), 56.4 kDa (possible tagged protein)


    Exposure time: 90 seconds


    Substrate: Perkin Elmer

References

This product has been referenced in:
  • Dong Z  et al. Ang-2 promotes lung cancer metastasis by increasing epithelial-mesenchymal transition. Oncotarget 9:12705-12717 (2018). Read more (PubMed: 29560103) »
  • Cao Y  et al. LncRNA ATB promotes proliferation and metastasis in A549 cells by down-regulation of microRNA-494. J Cell Biochem 119:6935-6942 (2018). Read more (PubMed: 29693289) »
See all 9 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up