Anti-SNAIL + SLUG antibody (ab167609)
Key features and details
- Mouse polyclonal to SNAIL + SLUG
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SNAIL + SLUG antibody
See all SNAIL + SLUG primary antibodies -
Description
Mouse polyclonal to SNAIL + SLUG -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Recombinant full length protein aa 1-264. Corresponding to Human SNAIL.
Sequence:MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL NPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGS QPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQA RKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSL LHKHQESGCSGCPR
Database link: NP_005976.2 -
Positive control
- SNAIl transfected 293T cell lysate. HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab167609 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. | |
| ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Relevance
Function: SNAIL is involved in the epithelial to mesenchymal transition (EMT) and formation and maintenance of embryonic mesoderm (By similarity). Binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. SLUG is a transcriptional repressor, involved in the generation and migration of neural crest cells. PTM: SNAIL is phosphorylated by GSK3B. Once phosphorylated, it becomes a target for BTRC ubiquitination. Ubiquitinated on Lys-98, Lys-137 and Lys-146 by FBXL14 and BTRC leading to degradation. BTRC-triggered ubiquitination requires previous GSK3B-mediated SNAI1 phosphorylation. Similarity: Both SNAIL and SLUG belong to the snail C2H2-type zinc-finger protein family. Tissue specificity: SNAIL is expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines. SLUG is expressed in placenta and adult heart, pancreas, liver, kidney and skeletal muscle. -
Cellular localization
Slug is generally nuclear, while Snail is known to be both cytoplasmic and nuclear. Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) snail is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs. -
Database links
- Entrez Gene: 6591 Human
- Entrez Gene: 6615 Human
- Omim: 604238 Human
- SwissProt: O43623 Human
- SwissProt: O95863 Human
- Unigene: 360174 Human
- Unigene: 48029 Human
-
Alternative names
- dJ710H13.1 antibody
- MGC10182 antibody
- Neural crest transcription factor Slug antibody
see all
Images
-
Western blot - Anti-SNAIL + SLUG antibody (ab167609)All lanes : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml
Lane 1 : SNAIL transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat anti-Mouse IgG
Predicted band size: 29 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-SNAIL + SLUG antibody (ab167609)Immunofluorescent analysis of HeLa cells labeling SNAIL with ab167609 at 10 µg/ml. -
Western blot - Anti-SNAIL + SLUG antibody (ab167609)Lane 1 : Monoclonal Mouse anti-GST at 1 µg
Lanes 2 & 5 : Milk at 5 %
Lane 3 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg
Lane 4 : Monoclonal Mouse anti-GST at 1 µg/ml
Lane 6 : Anti-SNAIL + SLUG antibody (ab167609) at 1 µg/ml
Lanes 1-3 : SNAIL-GST fusion protein
Lanes 4-6 : SLUG-GST-fusion protein
Lysates/proteins at 0.2 µg per lane.
Secondary
All lanes : HRP conjugated Goat anti-mouse at 1/5000 dilution
Predicted band size: 29 kDa
Additional bands at: 55.5 kDa (possible tagged protein), 56.4 kDa (possible tagged protein)
Exposure time: 90 secondsSubstrate: Perkin Elmer
Protocols
Datasheets and documents
References (14)
ab167609 has been referenced in 14 publications.
- Zhao W et al. MicroRNA-153 suppresses cell invasion by targeting SNAI1 and predicts patient prognosis in glioma. Oncol Lett 17:1189-1195 (2019). PubMed: 30655883
- Xiong W et al. E2 -mediated EMT by activation of ß-catenin/Snail signalling during the development of ovarian endometriosis. J Cell Mol Med 23:8035-8045 (2019). PubMed: 31560827
- Yan P et al. Tamoxifen attenuates dialysate-induced peritoneal fibrosis by inhibiting GSK-3ß/ß-catenin axis activation. Biosci Rep 38:N/A (2018). PubMed: 30061174
- Li Q et al. HSCs-derived COMP drives hepatocellular carcinoma progression by activating MEK/ERK and PI3K/AKT signaling pathways. J Exp Clin Cancer Res 37:231 (2018). PubMed: 30231922
- Dong Z et al. Ang-2 promotes lung cancer metastasis by increasing epithelial-mesenchymal transition. Oncotarget 9:12705-12717 (2018). PubMed: 29560103
