Overview

  • Product name

    Anti-SNAP25 Interacting Protein antibody
    See all SNAP25 Interacting Protein primary antibodies
  • Description

    Rabbit polyclonal to SNAP25 Interacting Protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human SNAP25 Interacting Protein aa 734-827.
    Sequence:

    NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGL QSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR


    Database link: Q9C0H9

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab244313 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance.
  • Tissue specificity

    Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue.
  • Sequence similarities

    Belongs to the SRCIN1 family.
  • Post-translational
    modifications

    Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell projection > axon. Cell projection > dendrite. Cell junction > synapse. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions.
  • Information by UniProt
  • Database links

  • Alternative names

    • p130Cas associated protein antibody
    • p130Cas-associated protein antibody
    • P140 antibody
    • p140Cap antibody
    • SNAP-25-interacting protein antibody
    • SNIP antibody
    • SRC kinase signaling inhibitor 1 antibody
    • SRCIN1 antibody
    • SRCN1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human adrenal gland tissue stained for SNAP25 Interacting Protein using ab244313 at 1/20 dilution in immunohistochemical analysis.

References

ab244313 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244313.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up