Overview

  • Product name

  • Description

    Rabbit polyclonal to SNAP29
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SNAP29 aa 75-148.
    Sequence:

    VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFK SKPVETPPEQNGTLTSQPNNRLKE


    Database link: O95721

  • Positive control

    • RT-4 and U-251 MG cell lysates; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 29 kDa.

Target

  • Function

    Involved in multiple membrane trafficking steps.
  • Tissue specificity

    Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas.
  • Involvement in disease

    Defects in SNAP29 are the cause of CEDNIK syndrome (CEDNIK) [MIM:609528]. CEDNIK is a neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis and palmoplantar keratoderma.
  • Sequence similarities

    Belongs to the SNAP-25 family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Cytoplasm. Membrane. Cell junction > synapse > synaptosome. Appears to be mostly membrane-bound, probably via interaction with syntaxins, but a significant portion is cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • CEDNIK antibody
    • FLJ21051 antibody
    • SNAP 29 antibody
    • SNAP-29 antibody
    • SNAP29 antibody
    • SNP29_HUMAN antibody
    • Soluble 29 kDa NSF attachment protein antibody
    • Synaptosomal associated protein 29 antibody
    • Synaptosomal associated protein 29kDa antibody
    • Synaptosomal-associated protein 29 antibody
    • Vesicle membrane fusion protein SNAP 29 antibody
    • Vesicle membrane fusion protein SNAP29 antibody
    • Vesicle-membrane fusion protein SNAP-29 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling SNAP29 with ab220873 at 4 μg/ml (green).

  • All lanes : Anti-SNAP29 antibody (ab220873) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 29 kDa

References

ab220873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up