Overview

  • Product name

  • Description

    Rabbit polyclonal to SNAP29
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human SNAP29 aa 1-258.
    Sequence:

    MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVL RRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQ DLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI STSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQ KIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKS TERKVRQL


    Database link: O95721

  • Positive control

    • IHC-P: Human kidney and gastric cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in multiple membrane trafficking steps.
  • Tissue specificity

    Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas.
  • Involvement in disease

    Defects in SNAP29 are the cause of CEDNIK syndrome (CEDNIK) [MIM:609528]. CEDNIK is a neurocutaneous syndrome characterized by cerebral dysgenesis, neuropathy, ichthyosis and palmoplantar keratoderma.
  • Sequence similarities

    Belongs to the SNAP-25 family.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Cytoplasm. Membrane. Cell junction > synapse > synaptosome. Appears to be mostly membrane-bound, probably via interaction with syntaxins, but a significant portion is cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • CEDNIK antibody
    • FLJ21051 antibody
    • SNAP 29 antibody
    • SNAP-29 antibody
    • SNAP29 antibody
    • SNP29_HUMAN antibody
    • Soluble 29 kDa NSF attachment protein antibody
    • Synaptosomal associated protein 29 antibody
    • Synaptosomal associated protein 29kDa antibody
    • Synaptosomal-associated protein 29 antibody
    • Vesicle membrane fusion protein SNAP 29 antibody
    • Vesicle membrane fusion protein SNAP29 antibody
    • Vesicle-membrane fusion protein SNAP-29 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for SNAP29 with ab229790 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for SNAP29 with ab229790 at 1/100 dilution in immunohistochemical analysis.

References

ab229790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up