Overview

  • Product name

  • Description

    Rabbit polyclonal to SND1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SND1 aa 779-906.
    Sequence:

    TLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLL NVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEY LNAQESAKSARLNLWRYGDFRADDADEF


    Database link: Q7KZF4

  • Positive control

    • IHC-P: Human pancreas, placenta, stomach and cerebral cortex tissue. WB: SK-BR-3, U-87 MG and EFO-21 cell lysates. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 102 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Functions as a bridging factor between STAT6 and the basal transcription factor. Plays a role in PIM1 regulation of MYB activity. Functions as a transcriptional coactivator for the Epstein-Barr virus nuclear antigen 2 (EBNA2).
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 4 TNase-like domains.
    Contains 1 Tudor domain.
  • Post-translational
    modifications

    Phosphorylated by PIM1 in vitro.
  • Cellular localization

    Cytoplasm. Nucleus. Melanosome. In IL-4 stimulated cells colocalizes with STAT6 in the nucleus. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • 100 kDa coactivator antibody
    • EBNA 2 co activator (100kD) antibody
    • EBNA2 coactivator p100 antibody
    • p100 antibody
    • p100 co-activator antibody
    • p100 coactivator antibody
    • p100 EBNA2 co activator antibody
    • SND 1 antibody
    • Snd1 antibody
    • SND1_HUMAN antibody
    • Staphylococcal nuclease and tudor domain containing 1 antibody
    • Staphylococcal nuclease domain containing 1 antibody
    • Staphylococcal nuclease domain containing protein 1 antibody
    • Staphylococcal nuclease domain-containing protein 1 antibody
    • TDRD11 antibody
    • TRD 11 antibody
    • TRD11 antibody
    • Tudor domain containing protein 11 antibody
    • Tudor domain-containing protein 11 antibody
    see all

Images

  • Anti-SND1 antibody (ab223770) at 0.4 µg/ml + SK-BR-3 cell lysate

    Predicted band size: 102 kDa

  • Immunohistochemical analysis of human cerebral cortex tissue labeling SND1 with ab223770 at 1/200 dilution.

     

  • All lanes : Anti-SND1 antibody (ab223770) at 0.4 µg/ml

    Lane 1 : U-87 MG cell lysate
    Lane 2 : EFO-21 cell lysate

    Predicted band size: 102 kDa

  • Immunohistochemical analysis of human stomach tissue labeling SND1 with ab223770 at 1/200 dilution.

  • Immunohistochemical analysis of human placenta tissue labeling SND1 with ab223770 at 1/200 dilution.

  • Immunohistochemical analysis of human pancreas tissue labeling SND1 with ab223770 at 1/200 dilution.

  • Immunohistochemical analysis of human skeletal muscle tissue labeling SND1 with ab223770 at 1/200 dilution. No staining is observed.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for SND1 (green) using ab223770 at 4 µg/ml in ICC/IF.

References

ab223770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up