Overview

  • Product name

  • Description

    Rabbit polyclonal to SNF2H
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human SNF2H aa 1-1052.
    Sequence:

    MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAAS AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE LFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEE DEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGIN GILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKR WVPTLRSVCLIGDKEQAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFN WRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLL NFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVE KSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILM QLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPKLKEQGSR VLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNST KFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKT VRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEML QMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLR NFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREA LRVSEPKAPKAPRPPKQPNVQDFQFFPPRLFELLEKEILFYRKTIGYKVP RNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQGFTNWNKRDFN QFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIM AQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEE DRFLICMLHKLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRC NTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKLK L


    Database link: O60264

  • Positive control

    • PC-3, H460, 293T, HepG2, SHSY5Y, mouse brain, mouse spleen, mouse testis lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 122 kDa.

Target

  • Function

    Helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity. Complexes containing SMARCA5 are capable of forming ordered nucleosome arrays on chromatin; this may require intact histone H4 tails. Also required for replication of pericentric heterochromatin in S-phase specifically in conjunction with BAZ1A. Probably plays a role in repression of polI dependent transcription of the rDNA locus, through the recruitment of the SIN3/HDAC1 corepressor complex to the rDNA promoter. Essential component of the WICH complex, a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH complex regulates the transcription of various genes, has a role in RNA polymerase I and RNA polymerase III transcription, mediates the histone H2AX phosphorylation at 'Tyr-142', and is involved in the maintenance of chromatin structures during DNA replication processes. Essential component of the NoRC (nucleolar remodeling complex) complex, a complex that mediates silencing of a fraction of rDNA by recruiting histone-modifying enzymes and DNA methyltransferases, leading to heterochromatin formation and transcriptional silencing.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family. ISWI subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 2 SANT domains.
  • Developmental stage

    Overexpressed in CD34-positive erythrocyte progenitor cells in acute myeloid leukemia. Down-regulation correlates with hematologic remission following chemotherapy.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4933427E24Rik antibody
    • D030040M08Rik antibody
    • D330027N15Rik antibody
    • EC 3.6.1.- antibody
    • hISWI antibody
    • hSNF2H antibody
    • ISWI antibody
    • MommeD4 antibody
    • SMARCA5 antibody
    • SMCA5_HUMAN antibody
    • Snf2h antibody
    • Sucrose nonfermenting like 5 antibody
    • Sucrose nonfermenting protein 2 homolog antibody
    • Sucrose nonfermenting, yeast, homolog of antibody
    • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5 antibody
    • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 antibody
    • WCRF135 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling SNF2H with ab185725 at 1/200. Magnification: 400x.
  • All lanes : Anti-SNF2H antibody (ab185725) at 1/500 dilution

    Lane 1 : PC-3 cell lysate
    Lane 2 : H460 cell lysate
    Lane 3 : 293T cell lysate
    Lane 4 : HepG2 cell lysate
    Lane 5 : SHSY5Y cell lysate
    Lane 6 : Mouse spleen cell lysate
    Lane 7 : Mouse brain cell lysate
    Lane 8 : Mouse testis cell lysate

    Predicted band size: 122 kDa

References

ab185725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up