Anti-SNM1A antibody (ab176690)
Key features and details
- Rabbit polyclonal to SNM1A
- Suitable for: IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SNM1A antibody
See all SNM1A primary antibodies -
Description
Rabbit polyclonal to SNM1A -
Host species
Rabbit -
Tested applications
Suitable for: IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human SNM1A aa 1-50. The exact sequence is proprietary. NP_055696.3.
Sequence:MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRN
Database link: Q6PJP8 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab176690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
May be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons. -
Tissue specificity
Expressed in brain, heart, kidney, liver, pancreas, placenta and skeletal muscle. -
Sequence similarities
Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family. -
Cellular localization
Nucleus. In some cells it may be found in typically 1 or 2 discrete nuclear aggregates of unknown function which also contain TP53BP1. Also found in multiple discrete nuclear foci which increase in number following treatment with ionizing radiation or interstrand cross-linking agents. These foci overlap with those formed by the MRN complex (composed of MRE11A, RAD50 and NBN) and BRCA1. - Information by UniProt
-
Database links
- Entrez Gene: 450747 Chimpanzee
- Entrez Gene: 101145990 Gorilla
- Entrez Gene: 9937 Human
- Entrez Gene: 100437792 Orangutan
- Omim: 609682 Human
- SwissProt: Q6PJP8 Human
- Unigene: 1560 Human
- Unigene: 703616 Human
-
Alternative names
- Dclre1a antibody
- DCR1A_HUMAN antibody
- DNA cross link repair 1A antibody
see all
Images
Datasheets and documents
References (0)
ab176690 has not yet been referenced specifically in any publications.