Anti-SNM1A antibody (ab176690)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-SNM1A antibody
See all SNM1A primary antibodies -
DescriptionRabbit polyclonal to SNM1A
-
Host speciesRabbit
-
Tested applicationsSuitable for: IPmore details
Unsuitable for: WB -
Species reactivityReacts with: Human
Predicted to work with: Chimpanzee, Gorilla, Orangutan
-
Immunogen
Synthetic peptide within Human SNM1A aa 1-50. The exact sequence is proprietary. NP_055696.3.
Sequence:MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRN
Database link: Q6PJP8
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab176690 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IP | Use at 2-10 µg/mg of lysate. |
Application notes
Is unsuitable for WB.
Target
-
FunctionMay be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons.
-
Tissue specificityExpressed in brain, heart, kidney, liver, pancreas, placenta and skeletal muscle.
-
Sequence similaritiesBelongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
-
Cellular localizationNucleus. In some cells it may be found in typically 1 or 2 discrete nuclear aggregates of unknown function which also contain TP53BP1. Also found in multiple discrete nuclear foci which increase in number following treatment with ionizing radiation or interstrand cross-linking agents. These foci overlap with those formed by the MRN complex (composed of MRE11A, RAD50 and NBN) and BRCA1.
- Information by UniProt
-
Database links
- Entrez Gene: 450747 Chimpanzee
- Entrez Gene: 101145990 Gorilla
- Entrez Gene: 9937 Human
- Entrez Gene: 100437792 Orangutan
- Omim: 609682 Human
- SwissProt: Q6PJP8 Human
- Unigene: 1560 Human
- Unigene: 703616 Human
-
Alternative names
- Dclre1a antibody
- DCR1A_HUMAN antibody
- DNA cross link repair 1A antibody
see all
Images
-
Immunoprecipitation - Anti-SNM1A antibody (ab176690)Detection of Human SNM1 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP 293T whole cell lysate loaded. ab176690 used for IP at 6 µg/mg lysate.
Datasheets and documents
Protocols
References
ab176690 has not yet been referenced specifically in any publications.
