Overview

  • Product name
  • Description
    Rabbit polyclonal to SNM1A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human SNM1A aa 1-50. The exact sequence is proprietary. NP_055696.3.
    Sequence:

    MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRN


    Database link: Q6PJP8

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Function
      May be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons.
    • Tissue specificity
      Expressed in brain, heart, kidney, liver, pancreas, placenta and skeletal muscle.
    • Sequence similarities
      Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
    • Cellular localization
      Nucleus. In some cells it may be found in typically 1 or 2 discrete nuclear aggregates of unknown function which also contain TP53BP1. Also found in multiple discrete nuclear foci which increase in number following treatment with ionizing radiation or interstrand cross-linking agents. These foci overlap with those formed by the MRN complex (composed of MRE11A, RAD50 and NBN) and BRCA1.
    • Information by UniProt
    • Database links
    • Alternative names
      • Dclre1a antibody
      • DCR1A_HUMAN antibody
      • DNA cross link repair 1A antibody
      • DNA cross link repair gene SNM1 antibody
      • DNA cross-link repair 1A protein antibody
      • hSNM1 antibody
      • hSNM1A antibody
      • PSO2 antibody
      • SNM1 homolog A antibody
      see all

    Images

    • Detection of Human SNM1 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP 293T whole cell lysate loaded. ab176690 used for IP at 6 µg/mg lysate.

    References

    ab176690 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab176690.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up