Overview

  • Product name
  • Description
    Rabbit polyclonal to SNRNP200
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human SNRNP200 aa 400-450. The exact sequence is proprietary. NP_054733.2
    Sequence:

    GEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPA L


    Database link: O75643

  • Positive control
    • HeLa, 293T, Jurkat and NIH3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7.0-8.0
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176715 was affinity purified using an epitope specific to SNRNP200 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 245 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Putative RNA helicase involved in the second step of RNA splicing. May promote one or more conformational changes in the dynamic network of RNA-RNA interactions in the spliceosome. Appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in SNRNP200 are the cause of retinitis pigmentosa type 33 (RP33) [MIM:610359]. It is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities
    Belongs to the helicase family. SKI2 subfamily.
    Contains 2 helicase ATP-binding domains.
    Contains 2 helicase C-terminal domains.
    Contains 2 SEC63 domains.
  • Domain
    Composed of two similar domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activating signal cointegrator 1 complex subunit 3-like 1 antibody
    • ASCC3L1 antibody
    • BRR2 antibody
    • BRR2 homolog antibody
    • HELIC2 antibody
    • RP33 antibody
    • SNRNP200 antibody
    • U5 small nuclear ribonucleoprotein 200 kDa helicase antibody
    • U5 snRNP-specific 200 kDa protein antibody
    • U5-200KD antibody
    • U520_HUMAN antibody
    see all

Images

  • SNRNP200 was immunoprecipitated from 1mg HeLa whole cell lysate using ab176715 at 6 μg/mg lysate (Lane 2), a rabbit anti-SNRNP200 antibody recognizing an upstream epitope (Lane 1) or control IgG (Lane 3). 20% of the Immunoprecipitate was loaded per lane and then immunobotted using ab176715 at 1.0 μg/ml.

    Detection:

    Chemiluminescence with exposure time of 10 seconds.

  • All lanes : Anti-SNRNP200 antibody (ab176715) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg
    Lane 5 : NIH3T3 whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 245 kDa


    Exposure time: 30 seconds

References

ab176715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up