Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRNP25
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human SNRNP25 aa 1-132.
    Sequence:

    MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDG EVMPVVVVQS ATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHL TSAGEKLTEDRKKLRDYGIRNR DEVSFIKKLRQK


    Database link: Q9BV90

  • Positive control

    • K562 cell lysate

Properties

  • Form

    Lyophilised:Reconstitute in 200 uL sterile distilled water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab200217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 15 kDa.

Target

Images

  • Anti-SNRNP25 antibody (ab200217) at 1/500 dilution + K562 cell lysate

    Predicted band size: 15 kDa

References

ab200217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up