Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRPB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human SNRPB2 aa 1-150.
    Sequence:

    MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRG QAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFAD KEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN


    Database link: SNRPB2

  • Positive control

    • IHC-P: Human cervical cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.
  • Sequence similarities

    Belongs to the RRM U1 A/B'' family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810052G09Rik antibody
    • MGC24807 antibody
    • MGC45309 antibody
    • Msl1 antibody
    • OTTHUMP00000030324 antibody
    • OTTHUMP00000030325 antibody
    • OTTMUSP00000016621 antibody
    • OTTMUSP00000016622 antibody
    • RP23-371L4.1 antibody
    • RU2B_HUMAN antibody
    • Small nuclear ribonucleoprotein polypeptide B antibody
    • Small nuclear ribonucleoprotein polypeptide B2 antibody
    • SNRPB2 antibody
    • U2 small nuclear ribonucleoprotein B'' antibody
    • U2 snRNP B'' antibody
    • U2B'' antibody
    see all

Images

  • Paraffin-embedded human cervical cancer tissue stained for SNRPB2 using ab234872 at 1/100 dilution in immunohistochemical analysis.

References

ab234872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up