Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRPD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human SNRPD1 aa 1-119. (Expressed in E.coli).
    Sequence:

    MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNR EPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR GRGRGRGRGRGRGRGGPRR


    Database link: P62314

  • Positive control

    • IHC-P: Human liver, prostate, kidney, stomach and cerebrum tissues. WB: HL-60 and Jurkat cell lysates; Rat testis lysate; Pig kidney lysate; Recombinant human SNRPD1 protein.
  • General notes

    Protein previously labeled as SNRPD1.

     This product was previously labelled as Sm-D1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233115 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 13 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.
  • Sequence similarities

    Belongs to the snRNP core protein family.
  • Post-translational
    modifications

    Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA407109 antibody
    • AL023031 antibody
    • HsT2456 antibody
    • Sm D1 antibody
    • Sm-D autoantigen antibody
    • Sm-D1 antibody
    • Small nuclear ribonucleoprotein D1 polypeptide antibody
    • Small nuclear ribonucleoprotein Sm D1 antibody
    • SmD autoantigen antibody
    • SMD1 antibody
    • SMD1_HUMAN antibody
    • snRNP core protein D1 antibody
    • SNRPD antibody
    • Snrpd1 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for SNRPD1 using ab233115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-SNRPD1 antibody (ab233115) at 2 µg/ml

    Lane 1 : Wild type Jurkat cells
    Lane 2 : SNRPD1 knockdown Jurkat cells

    Predicted band size: 13 kDa

  • Paraffin-embedded human prostate tissue stained for SNRPD1 using ab233115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for SNRPD1 using ab233115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for SNRPD1 using ab233115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for SNRPD1 using ab233115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-SNRPD1 antibody (ab233115) at 1 µg/ml + Recombinant human SNRPD1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 13 kDa

  • All lanes : Anti-SNRPD1 antibody (ab233115) at 1 µg/ml

    Lane 1 : HL-60 (human promyelocytic leukemia cell line) cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 3 : Rat testis lysate
    Lane 4 : Pig kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 13 kDa

References

ab233115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up