Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRPD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human SNRPD1 aa 1-119.
    Sequence:

    MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNR EPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR GRGRGRGRGRGRGRGGPRR


    Database link: P62314

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: PC-3 cells. WB: HEK-293 whole cell lysate.
  • General notes

    Protein previously labeled as SNRPD1.

     This product was previously labelled as Sm-D1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.
  • Sequence similarities

    Belongs to the snRNP core protein family.
  • Post-translational
    modifications

    Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA407109 antibody
    • AL023031 antibody
    • HsT2456 antibody
    • Sm D1 antibody
    • Sm-D autoantigen antibody
    • Sm-D1 antibody
    • Small nuclear ribonucleoprotein D1 polypeptide antibody
    • Small nuclear ribonucleoprotein Sm D1 antibody
    • SmD autoantigen antibody
    • SMD1 antibody
    • SMD1_HUMAN antibody
    • snRNP core protein D1 antibody
    • SNRPD antibody
    • Snrpd1 antibody
    see all

Images

  • Anti-SNRPD1 antibody (ab236902) at 1/200 dilution + HEK-293 (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human kidney tissue stained for SNRPD1 using ab236902 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for SNRPD1 (green) using ab236902 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up