Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRPD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human SNRPD1 aa 38-70. The exact sequence is proprietary.
    Sequence:

    THLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

  • Positive control

    • Jurkat cell lysate and human kidney tissue.
  • General notes

    Protein previously labeled as SNRPD1.

     This product was previously labelled as Sm-D1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab50940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 13 kDa (predicted molecular weight: 13 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.
  • Sequence similarities

    Belongs to the snRNP core protein family.
  • Post-translational
    modifications

    Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA407109 antibody
    • AL023031 antibody
    • HsT2456 antibody
    • Sm D1 antibody
    • Sm-D autoantigen antibody
    • Sm-D1 antibody
    • Small nuclear ribonucleoprotein D1 polypeptide antibody
    • Small nuclear ribonucleoprotein Sm D1 antibody
    • SmD autoantigen antibody
    • SMD1 antibody
    • SMD1_HUMAN antibody
    • snRNP core protein D1 antibody
    • SNRPD antibody
    • Snrpd1 antibody
    see all

Images

  • Anti-SNRPD1 antibody (ab50940) at 0.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa
    Observed band size: 13 kDa

  • ab50940 at 4ug/ml staining human SNRPD1 in epithelial cells of renal tubule in human kidney by Immunohistochemistry, Paraffin embedded tissue.

References

ab50940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab50940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up