Anti-SNRPD3/Sm-D3 antibody (ab157118)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SNRPD3/Sm-D3 antibody
See all SNRPD3/Sm-D3 primary antibodies -
Description
Rabbit polyclonal to SNRPD3/Sm-D3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Lizard, Rhesus monkey, Gorilla, Orangutan, Zebra finch, Xenopus tropicalis
-
Immunogen
Synthetic peptide corresponding to Human SNRPD3/Sm-D3 aa 76-126.
Sequence:MLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKR R
Database link: NP_004166.1 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
Previously labelled as SNRPD3.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab157118 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Predicted molecular weight: 14 kDa. | |
| IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. -
Sequence similarities
Belongs to the snRNP core protein family. -
Post-translational
modificationsMethylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
Arg-97 is dimethylated, probably to asymmetric dimethylarginine. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 416947 Chicken
- Entrez Gene: 100611816 Chimpanzee
- Entrez Gene: 617823 Cow
- Entrez Gene: 607772 Dog
- Entrez Gene: 101125349 Gorilla
- Entrez Gene: 6634 Human
- Entrez Gene: 67332 Mouse
- Entrez Gene: 100446939 Orangutan
see all -
Alternative names
- Sm D3 antibody
- Sm-D3 antibody
- small nuclear ribonucleoprotein D3 polypeptide 18kDa antibody
see all
Images
-
Immunoprecipitation - Anti-SNRPD3/Sm-D3 antibody (ab157118)Immunoprecipitation analysis of whole cell lysate from HeLa cells (1 mg for IP; 20% of IP loaded), labeling SNRPD3/Sm-D3 with ab157118 at 6 µg/mg lysate (lane 1), control IgG (lane 2). For blotting immunoprecipitated SNRPD3/Sm-D3, ab157118 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
-
Western blot - Anti-SNRPD3/Sm-D3 antibody (ab157118)All lanes : Anti-SNRPD3/Sm-D3 antibody (ab157118) at 0.4 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 14 kDa
Exposure time: 3 minutes
Datasheets and documents
References
ab157118 has not yet been referenced specifically in any publications.
