Anti-SNRPD3/Sm-D3 antibody (ab157118)
Key features and details
- Rabbit polyclonal to SNRPD3/Sm-D3
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SNRPD3/Sm-D3 antibody
See all SNRPD3/Sm-D3 primary antibodies -
Description
Rabbit polyclonal to SNRPD3/Sm-D3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Xenopus laevis, Chimpanzee, Lizard, Rhesus monkey, Gorilla, Orangutan, Zebra finch, Xenopus tropicalis -
Immunogen
Synthetic peptide corresponding to Human SNRPD3/Sm-D3 aa 76-126.
Sequence:MLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKR R
Database link: NP_004166.1 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
Previously labelled as SNRPD3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab157118 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Predicted molecular weight: 14 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. -
Sequence similarities
Belongs to the snRNP core protein family. -
Post-translational
modificationsMethylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
Arg-97 is dimethylated, probably to asymmetric dimethylarginine. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 416947 Chicken
- Entrez Gene: 100611816 Chimpanzee
- Entrez Gene: 617823 Cow
- Entrez Gene: 607772 Dog
- Entrez Gene: 101125349 Gorilla
- Entrez Gene: 6634 Human
- Entrez Gene: 67332 Mouse
- Entrez Gene: 100446939 Orangutan
see all -
Alternative names
- Sm D3 antibody
- Sm-D3 antibody
- small nuclear ribonucleoprotein D3 polypeptide 18kDa antibody
see all
Images
-
Immunoprecipitation analysis of whole cell lysate from HeLa cells (1 mg for IP; 20% of IP loaded), labeling SNRPD3/Sm-D3 with ab157118 at 6 µg/mg lysate (lane 1), control IgG (lane 2). For blotting immunoprecipitated SNRPD3/Sm-D3, ab157118 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
-
All lanes : Anti-SNRPD3/Sm-D3 antibody (ab157118) at 0.4 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 14 kDa
Exposure time: 3 minutes
Protocols
Datasheets and documents
References (0)
ab157118 has not yet been referenced specifically in any publications.