Overview

  • Product name

  • Description

    Rabbit polyclonal to SNRPN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Cynomolgus monkey, Hedgehog, Orangutan, Tammar wallaby, Gray short-tailed opossum
  • Immunogen

    Recombinant fragment corresponding to Human SNRPN aa 30-122.
    Sequence:

    TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVS MTVEGPPPKDTGIARVPLAGAAGGPGVGRAAGRGVPAGVPIPQ


    Database link: P63162

  • Positive control

    • WB: NTERA-2, NIH/3T3 and NBT-II cell lysates. IHC-P: Human lateral ventricle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 25 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human lateral ventricle tissue stained for SNRPN using ab224330 at 1/20 dilution in immunohistochemical analysis.

  • Anti-SNRPN antibody (ab224330) at 1/100 dilution + NTERA-2 cell lysate

    Developed using the ECL technique.

    Predicted band size: 25 kDa

  • All lanes : Anti-SNRPN antibody (ab224330) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 25 kDa

References

ab224330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up