Overview

  • Product name

    Anti-SNT2 antibody
  • Description

    Rabbit polyclonal to SNT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SNT2 aa 101-400.
    Sequence:

    LQDLMQCNSINVMEEPVIITRNSHPAELDLPRAPQPPNALGYTVSSFSNG CPGEGPRFSAPRRLSTSSLRHPSLGEESTHALIAPDEQSHTYVNTPASED DHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQVKFVLGPTPAR RHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSR DGLTPSSNGFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVF


    Database link: O43559

  • Positive control

    • ICC/IF: U-251 MG cells. IHC-P: Human cervical cancer and skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/200 - 1/500.

Target

  • Relevance

    SNT2 is a substrate for the fibroblast growth factor receptor. It functions in linking FGF receptor stimulation to activators of Ras.
  • Cellular localization

    Plasma membrane
  • Database links

  • Alternative names

    • FGFR signalling adaptor SNT2 antibody
    • FGFR substrate 3 antibody
    • Fibroblast growth factor receptor substrate 3 antibody
    • FRS2 beta antibody
    • FRS2B antibody
    • FRS3 antibody
    • FRS3 protein antibody
    • MGC17167 antibody
    • SNT 2 antibody
    • Suc1 associated neurotrophic factor target 2 (FGFR signalling adaptor) antibody
    • Suc1 associated neurotrophic factor target 2 antibody
    see all

Images

  • U-251 MG (human brain glioma cell line) cells stained for SNT2 using ab238823 at a dilution of 1/466 in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • Paraffin-embedded human cervical cancer tissue stained for SNT2 with ab238823 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for SNT2 with ab238823 at 1/100 dilution in immunohistochemical analysis.

References

ab238823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up