For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    snx-482-r-type-ca2-cav23-channel-blocker-ab120259.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Biochemicals Product Range Just Add Water
Share by email

SNX 482, R-Type Ca2+ (Cav2.3) channel blocker (ab120259)

  • Datasheet
  • SDS
  • COA
Submit a review Q&A (1)References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Chemical Structure - SNX 482, R-Type Ca<sup>2+</sup> (Ca<sub>v</sub>2.3) channel blocker (ab120259)

    Key features and details

    • R-Type Ca2+ (Cav2.3) channel blocker
    • CAS Number: 203460-30-4
    • Soluble in 0.1% NH4OH
    • Form / State: Solid
    • Source: Synthetic

    You may also be interested in

    Assay
    Product image
    Fluo-8 Calcium Flux Assay Kit - No Wash (ab112129)
    Biochemical
    Product image
    (R,S)-CPP, NMDA antagonist (ab120160)
    Primary
    Product image
    Anti-SV2A antibody (ab32942)

    View more associated products

    Overview

    • Product name

      SNX 482, R-Type Ca2+ (Cav2.3) channel blocker
    • Description

      R-Type Ca2+ (Cav2.3) channel blocker
    • Biological description

      Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (α1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concentrations, also blocks Cav2.1 channels in chromaffin cells.

    • CAS Number

      203460-30-4
    • Chemical structure

      Chemical Structure

    Properties

    • Molecular weight

      4495.01
    • Molecular formula

      C192H274N52O60S7
    • Sequence

      GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Modifications: Disulfide bonds: 7-21, 14-26, 20-33)
    • PubChem identifier

      90488787
    • Storage instructions

      Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
    • Solubility overview

      Soluble in 0.1% NH4OH
    • Handling

      Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

      Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

    • Source

      Synthetic

    • Research areas

      • Biochemicals
      • Product Range
      • Just Add Water
      • Biochemicals
      • Chemical Type
      • Biochemicals
      • Biochemicals
      • Chemical Type
      • Bioactive peptides
      • Biochemicals
      • Pharmacology
      • Ion Channels
      • Calcium
      • Blockers
      • Biochemicals
      • Pharmacology
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Heart disease
      • Calcium
      • Biochemicals
      • Research Area
      • Heart disease
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Pain & inflammation
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Alzheimer's Disease
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Diabetes
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Diabetes
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Heart disease
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Hypertension
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Hypertension
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Obesity
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Obesity
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Pain & inflammation
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Respiratory disease
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Respiratory disease
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Stroke
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Stroke
      • Signaling
      • Ca2+ signaling
      • Cav channels
      • Biochemicals
      • Research Area
      • Cancer
      • Ca2+ signaling
      • Cav channels

    Images

    • Chemical Structure - SNX 482, R-Type Ca<sup>2+</sup> (Ca<sub>v</sub>2.3) channel blocker (ab120259)
      Chemical Structure - SNX 482, R-Type Ca2+ (Cav2.3) channel blocker (ab120259)
      2D chemical structure image of ab120259, SNX 482, R-Type Ca2+ (Cav2.3) channel blocker

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download
    • COA

    References (3)

    Publishing research using ab120259? Please let us know so that we can cite the reference in this datasheet.

    ab120259 has been referenced in 3 publications.

    • Prigge CL  et al. M1 ipRGCs Influence Visual Function through Retrograde Signaling in the Retina. J Neurosci 36:7184-97 (2016). PubMed: 27383593
    • Toft-Bertelsen TL  et al. Regulation of Ca2+ channels by SNAP-25 via recruitment of syntaxin-1 from plasma membrane clusters. Mol Biol Cell 27:3329-3341 (2016). PubMed: 27605709
    • Ramachandra R  et al. Identification of CaV channel types expressed in muscle afferent neurons. J Neurophysiol 110:1535-43 (2013). PubMed: 23843437

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question


    Guten Tag,



    wir haben von ihnen SNX482 Asc-259 gekauft. Auf dem Datenblatt ist nur vermerkt dass man SNX482 bei -20°C lagern soll wenn es noch nicht gelöst ist. Können sie mir Informationen geben, wie ich eine 600nM SNX482-Lösung am besten lagere und wie lange SNX stabil ist in Lösung?



    Mit freundlichen Grüßen




    Read More

    Abcam community

    Verified customer

    Asked on Jan 19 2012

    Answer

    Vielen Dank für Ihre Anfrage.

    Ich kann bestätigen, dass SNX482 Asc-259 (ab120259) bei -20C gelagert werden sollte auch wenn es gelöst ist.
    Generell empfehlen wir, wenn möglich, Lösungen immer frisch anzusetzen.

    Ich empfehle, die Lösung zu aliquotieren und nicht länger als einen Monat aufzubewahren. Außerdem sollte dieses Produkt nicht mehreren Gefrierzyklen ausgesetzt werden.

    Da es sich hier um ein Peptid handelt, möchte ich Daraufhinweisen, dass Proteinase-freies Wasser benutzt werden sollte.

    Bevor Sie das Peptid für Ihre Versuche einsetzen, sollte es vollständig aufgetaut werden und auf langsam auf Raumtemperatur gebracht werden.

    Ich hoffe, diese Information ist hilfreich. Bitte zögern Sie nicht, sich wieder zu melden, falls Sie weitere Fragen haben.

    Read More

    Abcam Scientific Support

    Answered on Jan 19 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.