SNX 482, R-Type Ca2+ (Cav2.3) channel blocker (ab120259)
Key features and details
- R-Type Ca2+ (Cav2.3) channel blocker
- CAS Number: 203460-30-4
- Soluble in 0.1% NH4OH
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
SNX 482, R-Type Ca2+ (Cav2.3) channel blocker -
Description
R-Type Ca2+ (Cav2.3) channel blocker -
Biological description
Peptide toxin that naturally occurs in the venom of the spider Hysterocrates gigas. Selectively blocks Cav2.3 (α1E, R-type) channels in a voltage dependent manner (IC50 = 15-30 nM). At higher concentrations, also blocks Cav2.1 channels in chromaffin cells.
-
CAS Number
203460-30-4 -
Chemical structure
Properties
-
Molecular weight
4495.01 -
Molecular formula
C192H274N52O60S7 -
Sequence
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Modifications: Disulfide bonds: 7-21, 14-26, 20-33) -
PubChem identifier
90488787 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in 0.1% NH4OH -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (3)
ab120259 has been referenced in 3 publications.
- Prigge CL et al. M1 ipRGCs Influence Visual Function through Retrograde Signaling in the Retina. J Neurosci 36:7184-97 (2016). PubMed: 27383593
- Toft-Bertelsen TL et al. Regulation of Ca2+ channels by SNAP-25 via recruitment of syntaxin-1 from plasma membrane clusters. Mol Biol Cell 27:3329-3341 (2016). PubMed: 27605709
- Ramachandra R et al. Identification of CaV channel types expressed in muscle afferent neurons. J Neurophysiol 110:1535-43 (2013). PubMed: 23843437