Overview

  • Product name

  • Description

    Rabbit polyclonal to SNX10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SNX10 aa 124-201.
    Sequence:

    HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDS ESSSSGLGHSSDDSSSHGCKVNTAPQES


    Database link: Q9Y5X0-1

  • Positive control

    • IHC-P: Human cervival cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in several stages of intracellular trafficking (By similarity). May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.
  • Cellular localization

    Cytoplasm. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2410004M09Rik antibody
    • MGC109202 antibody
    • MGC33054 antibody
    • OPTB8 antibody
    • SNX10 antibody
    • SNX10_HUMAN antibody
    • Sorting nexin 10 antibody
    • Sorting nexin-10 antibody
    see all

Images

  • Paraffin-embedded human cervical cancer tissue stained for SNX10 with ab238874 at a 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up