Overview

  • Product name

  • Description

    Rabbit polyclonal to SNX12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human SNX12 aa 2-172.
    Sequence:

    MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTY EVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKR QLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEA IDRNYVPGKSLAVSCPGWSAVA


    Database link: Q9UMY4

  • Positive control

    • WB: PC-3 and A549 cell lysate. IHC-P: Human kidney tissue. ICC/IF: A549 cells. IP: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Predicted molecular weight: 20 kDa.
ICC/IF 1/200 - 1/500.
IP 1/200 - 1/2000.

Target

  • Function

    May be involved in several stages of intracellular trafficking.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610001F05Rik antibody
    • AW045757 antibody
    • MGC118982 antibody
    • MGC118983 antibody
    • RGD1565585 antibody
    • RP23-356J7.1 antibody
    • SDP8 antibody
    • SNX 12 antibody
    • SNX12 antibody
    • SNX12_HUMAN antibody
    • Sorting nexin 12 antibody
    • Sorting nexin-12 antibody
    see all

Images

  • All lanes : Anti-SNX12 antibody (ab236600) at 1/500 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 20 kDa

  • Paraffin-embedded human kidney tissue stained for SNX12 using ab236600 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling SNX12 (green) using ab236600 at 1/200 dilution in ICC/IF. Counter stained with DAPI (blue). The cells were blocked in 10% normal goat serum and incubated with primary antibody at 4°C overnight. The secondary antibody was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

  • SNX12 was immunoprecipitated from 0.5 mg A549 (human lung carcinoma cell line) whole cell lysate with ab236600. 

    Lane 1: Rabbit control IgG instead of ab236600 in A549 whole cell lysate.
    Lane 2: ab236600 IP in A549 whole cell lysate. 
    Lane 3: A549 whole cell lysate.

References

ab236600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up