Overview

  • Product name

    Anti-SNX17 antibody
  • Description

    Rabbit polyclonal to SNX17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human SNX17 aa 280-457.
    Sequence:

    DFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVTSSVPL PSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSM VDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLESPDATRESM VKLSSKLSAVSLRGIGSPSTDASASDVH


    Database link: Q15036

  • Positive control

    • WB: Mouse liver and kidney tissue lysates. IHC-P: Human breast cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 53 kDa (predicted molecular weight: 50,53 kDa).

Target

  • Function

    Critical regulator of endosomal recycling of numerous receptors, channels, and other transmembrane proteins. Binds to NPxY sequences in the cytoplasmic tails of target cargos. Plays a role in the sorting of endocytosed LRP1 and APP, and prevents their degradation. Required for maintenance of normal cell surface levels of APP and LRP1. Recycles internalized integrins ITGB1, ITGB5 and their associated alpha subunits, preventing them from lysosomal degradation. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)).
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
    Contains 1 Ras-associating domain.
  • Domain

    The PX domain mediates specific binding to phosphatidylinositol 3-phosphate (PtdIns(P3)). Required for association with endosomes.
    The PTB-like F3 module within the FERM-like domain mediates cargo recognition via their NPxY sequences, while the F1 module (Ras-associating) is responsible for interaction with membrane-bound HRAS.
  • Cellular localization

    Cytoplasm. Early endosome. Cytoplasmic vesicle membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Similar to a putative C elegans gene encoded in cosmid F17H10 antibody
    • Snx17 antibody
    • SNX17_HUMAN antibody
    • Sorting nexin 17 antibody
    • Sorting nexin-17 antibody
    see all

Images

  • All lanes : Anti-SNX17 antibody (ab223046) at 1/500 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 50,53 kDa
    Observed band size: 53 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for SNX17 (green) using ab223046 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human breast cancer tissue stained for SNX17 using ab223046 at 1/100 dilution in immunohistochemical analysis.

References

ab223046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up