Overview

  • Product name

  • Description

    Rabbit polyclonal to SNX18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human SNX18 aa 449-628.
    Sequence:

    ANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGD AYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQ VIWSVLCRLKGATLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCST GSFLLEYLALGNEYSFSKVQRVPLMTVLSF


    Database link: Q96RF0

  • Positive control

    • WB: A549 and HeLa whole cell lysates; Mouse kidney lysate. IHC-P: Human tonsil and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 69 kDa.

Target

  • Function

    May be involved in several stages of intracellular trafficking. Plays a role in endocytosis via clathrin-coated pits, but also clathrin-independent, actin-dependent fluid-phase endocytosis. Plays a role in macropinocytosis. Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate and promotes membrane tubulation. Stimulates the GTPase activity of DNM2. Promotes DNM2 location at the plasma membrane.
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 BAR domain.
    Contains 1 PX (phox homology) domain.
    Contains 1 SH3 domain.
  • Domain

    The PX domain mediates interaction with membranes enriched in phosphatidylinositol-4,5-bisphosphate.
  • Cellular localization

    Endomembrane system. Endosome membrane. Cell membrane. Localized at sites of endocytosis at the cell membrane. Detected on newly formed macropinosomes. Partially colocalized with clathrin and dynamin at the cell membrane. Transiently recruited to clathrin-coated pits at a late stage of clathrin-coated vesicle formation.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ11997 antibody
    • FLJ32560 antibody
    • FLJ61062 antibody
    • MGC150827 antibody
    • MGC150829 antibody
    • SH3 and PX domain containing protein 3B antibody
    • SH3 and PX domain-containing protein 3B antibody
    • SH3PX2 antibody
    • SH3PXD3B antibody
    • SNAG 1 antibody
    • SNAG1 antibody
    • SNX18 antibody
    • SNX18_HUMAN antibody
    • Sorting nexin 18 antibody
    • Sorting nexin associated golgi protein 1 antibody
    • Sorting nexin-18 antibody
    • Sorting nexin-associated Golgi protein 1 antibody
    see all

Images

  • All lanes : Anti-SNX18 antibody (ab237808) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 69 kDa

  • Paraffin-embedded human tonsil tissue stained for SNX18 using ab237808 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for SNX18 using ab237808 at 1/100 dilution in immunohistochemical analysis.

References

ab237808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up