Anti-SNX27 antibody (ab223121)
Key features and details
- Rabbit polyclonal to SNX27
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-SNX27 antibody
See all SNX27 primary antibodies -
Description
Rabbit polyclonal to SNX27 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow
-
Immunogen
Recombinant fragment corresponding to Human SNX27 aa 458-497.
Sequence:EEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKP
Database link: Q96L92 -
Positive control
- WB: HepG2, Jurkat and A549 whole cell lysates; Mouse brain lysate; Rat heart and liver lysates. IHC-P: Human small intestine tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab223121 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. Detects a band of approximately 62,53 kDa (predicted molecular weight: 28,53,60,62 kDa). | |
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Involved in endocytic trafficking (By similarity). In T lymphocytes, participates in endocytic recycling pathway. Recruits PSCDBP and HT4R to early endosomes. -
Tissue specificity
Expressed in cells of hematopoietic origin (at protein level). -
Sequence similarities
Belongs to the sorting nexin family.
Contains 1 PDZ (DHR) domain.
Contains 1 PX (phox homology) domain.
Contains 1 Ras-associating domain. -
Domain
The PDZ domain mediates the interaction with DGKZ, PSCDBP and HT4R and is responsible for vesicular localization. -
Cellular localization
Cytoplasm > cytosol. Early endosome. In T-lymphocytes, recruited from the cytosol to sorting endosomes by phosphoinositide-3-kinase products. - Information by UniProt
-
Database links
- Entrez Gene: 513214 Cow
- Entrez Gene: 81609 Human
- Entrez Gene: 76742 Mouse
- Entrez Gene: 260323 Rat
- Omim: 611541 Human
- SwissProt: A5PKA5 Cow
- SwissProt: Q96L92 Human
- SwissProt: Q3UHD6 Mouse
see all -
Alternative names
- KIAA0488 antibody
- Methamphetamine responsive transcript 1 antibody
- MGC126871 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX27 antibody (ab223121)Paraffin-embedded human small intestine tissue stained for SNX27 using ab223121 at 1/100 dilution in immunohistochemical analysis.
-
Western blot - Anti-SNX27 antibody (ab223121)All lanes : Anti-SNX27 antibody (ab223121) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 4 : Mouse brain lysate
Lane 5 : Rat heart lysate
Lane 6 : Rat liver lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 28,53,60,62 kDa
Observed band size: 53,62 kDa why is the actual band size different from the predicted?
Protocols
References (0)
ab223121 has not yet been referenced specifically in any publications.
