Anti-SNX27 antibody (ab223121)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-SNX27 antibody
See all SNX27 primary antibodies -
Description
Rabbit polyclonal to SNX27 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human SNX27 aa 458-497.
Sequence:EEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKP
Database link: Q96L92 -
Positive control
- WB: HepG2, Jurkat and A549 whole cell lysates; Mouse brain lysate; Rat heart and liver lysates. IHC-P: Human small intestine tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab223121 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 62,53 kDa (predicted molecular weight: 28,53,60,62 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Involved in endocytic trafficking (By similarity). In T lymphocytes, participates in endocytic recycling pathway. Recruits PSCDBP and HT4R to early endosomes. -
Tissue specificity
Expressed in cells of hematopoietic origin (at protein level). -
Sequence similarities
Belongs to the sorting nexin family.
Contains 1 PDZ (DHR) domain.
Contains 1 PX (phox homology) domain.
Contains 1 Ras-associating domain. -
Domain
The PDZ domain mediates the interaction with DGKZ, PSCDBP and HT4R and is responsible for vesicular localization. -
Cellular localization
Cytoplasm > cytosol. Early endosome. In T-lymphocytes, recruited from the cytosol to sorting endosomes by phosphoinositide-3-kinase products. - Information by UniProt
-
Database links
- Entrez Gene: 513214 Cow
- Entrez Gene: 81609 Human
- Entrez Gene: 76742 Mouse
- Entrez Gene: 260323 Rat
- Omim: 611541 Human
- SwissProt: A5PKA5 Cow
- SwissProt: Q96L92 Human
- SwissProt: Q3UHD6 Mouse
see all -
Alternative names
- KIAA0488 antibody
- Methamphetamine responsive transcript 1 antibody
- MGC126871 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX27 antibody (ab223121)
Paraffin-embedded human small intestine tissue stained for SNX27 using ab223121 at 1/100 dilution in immunohistochemical analysis.
-
All lanes : Anti-SNX27 antibody (ab223121) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 4 : Mouse brain lysate
Lane 5 : Rat heart lysate
Lane 6 : Rat liver lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 28,53,60,62 kDa
Observed band size: 53,62 kDa why is the actual band size different from the predicted?
References
ab223121 has not yet been referenced specifically in any publications.