Overview

  • Product name

  • Description

    Rabbit polyclonal to SNX27
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human SNX27 aa 458-497.
    Sequence:

    EEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKP


    Database link: Q96L92

  • Positive control

    • WB: HepG2, Jurkat and A549 whole cell lysates; Mouse brain lysate; Rat heart and liver lysates. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 62,53 kDa (predicted molecular weight: 28,53,60,62 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in endocytic trafficking (By similarity). In T lymphocytes, participates in endocytic recycling pathway. Recruits PSCDBP and HT4R to early endosomes.
  • Tissue specificity

    Expressed in cells of hematopoietic origin (at protein level).
  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PX (phox homology) domain.
    Contains 1 Ras-associating domain.
  • Domain

    The PDZ domain mediates the interaction with DGKZ, PSCDBP and HT4R and is responsible for vesicular localization.
  • Cellular localization

    Cytoplasm > cytosol. Early endosome. In T-lymphocytes, recruited from the cytosol to sorting endosomes by phosphoinositide-3-kinase products.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0488 antibody
    • Methamphetamine responsive transcript 1 antibody
    • MGC126871 antibody
    • MGC126873 antibody
    • MGC20471 antibody
    • MRT1 antibody
    • MY014 antibody
    • OTTHUMP00000042487 antibody
    • RP11-98D18.12 antibody
    • SNX27 antibody
    • SNX27_HUMAN antibody
    • Sorting nexin family member 27 antibody
    • Sorting nexin-27 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for SNX27 using ab223121 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-SNX27 antibody (ab223121) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : Mouse brain lysate
    Lane 5 : Rat heart lysate
    Lane 6 : Rat liver lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 28,53,60,62 kDa
    Observed band size: 53,62 kDa
    why is the actual band size different from the predicted?

References

ab223121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up