Overview

  • Product name

  • Description

    Rabbit polyclonal to Snx6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Snx6 aa 1-290.
    Sequence:

    MTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVF LEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTF LLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKF FLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRS LVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFK TRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT


    Database link: Q9UNH7-2

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 34, 47 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Snx6 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associates with the long isoform of the leptin receptor, the transforming growth factor-beta family of receptor serine-threonine kinases, and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor. This protein may form oligomeric complexes with family member proteins through interactions of both the PX domain and the coiled coil regions of the molecules. Translocation of this protein from the cytoplasm to the nucleus occurs after binding to proviral integration site 1 protein. This gene results in two transcripts encoding two distinct isoforms.
  • Cellular localization

    Endosomes
  • Database links

  • Alternative names

    • Sorting Nexin 6 antibody
    • TFAF2 antibody
    • TRAF4 Associated Factor 2 antibody

Images

  • Anti-Snx6 antibody (ab235342) at 1/500 dilution + HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 34, 47 kDa

  • Paraffin-embedded human small intestine tissue stained for Snx6 with ab235342 at 1/100 dilution in immunohistochemical analysis.

References

ab235342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up