Overview

  • Product name

  • Description

    Rabbit polyclonal to SNX7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human SNX7 aa 227-301.
    Sequence:

    IHILWSASEEDLVDTLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVL YSEMLMGVMKRRDQIQAELDSKVEV


    Database link: Q9UNH6

  • Positive control

    • A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • Immunofluorescent analysis of A431 cells (PFA-fixed/Triton X-100 permeabilized) labeling SNX7 with ab220662 at 4μg/ml (green).

References

ab220662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up