Anti-SNX8 antibody [OTI3C4] (ab119388)

Submit a review Submit a question

Overview

  • Product name

    Anti-SNX8 antibody [OTI3C4]

  • Description

    Mouse monoclonal [OTI3C4] to SNX8

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant full length protein corresponding to Human SNX8 aa 1-465. NP_037453. Produced in HEK-293T cells.
    Sequence:

    MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPA PSRMQMPQGNPLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQ RFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRR ALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNC KLATRAKDFLPADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNA ADLLIFGKELSAIGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLAD KAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQE TQLIHVYLPLTSHILRAFVNSQIQGHKEMSKVWNDLRPKLSCLFAGPHST LTPPCSPPEDGLCPH


    Database link: Q9Y5X2

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: HeLa, A549, COS-7, Jurkat and MCF7 extracts. HEK-293T cell lysate transfected with pCMV6-ENTRY SNX8 cDNA. IHC-P: Human breast adenocarcinoma, kidney, liver, bladder carcinoma and tonsil tissue. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY SNX8 cDNA. FC: Jurkat cells.

  • General notes

    Clone OTI3C4 (formerly 3C4).

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...

  • Purity

    Affinity purified

  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.

  • Clonality

    Monoclonal

  • Clone number

    OTI3C4

  • Isotype

    IgG2a

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab119388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 53 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Flow Cyt 1/100.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 
ICC/IF 1/100.

Target

  • Function

    May be involved in several stages of intracellular trafficking. May play a role in intracellular protein transport from early endosomes to the trans-Golgi network.

  • Sequence similarities

    Belongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.

  • Cellular localization

    Early endosome membrane. Colocalizes with retromer components.
  • Information by UniProt

  • Database links

    • Alternative names

      • DKFZp761E1721 antibody
      • Highly similar to MVP1 PROTEIN Saccharomyces cerevisiae antibody
      • Mvp1 antibody
      • OTTHUMP00000200137 antibody
      • SNX 8 antibody
      • SNX8 antibody
      • SNX8_HUMAN antibody
      • Sorting nexin 8 antibody
      • Sorting nexin-8 antibody
      see all

    Images

    • Western blot - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Western blot - Anti-SNX8 antibody [OTI3C4] (ab119388)
      All lanes : Anti-SNX8 antibody [OTI3C4] (ab119388) at 1/200 dilution

      Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) extracts
      Lane 2 : A549 (Human lung carcinoma cell line) extracts
      Lane 3 : COS-7 (African green monkey kidney fibroblast-like cell line) extracts
      Lane 4 : Jurkat (Human T cell leukemia cell line from peripheral blood) extracts
      Lane 5 : MCF7 (Human breast adenocarcinoma cell line) extracts

      Lysates/proteins at 10 µg per lane.

      Predicted band size: 53 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Paraffin-embedded human breast adenocarcinoma tissue stained for SNX8 with ab119388 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

    • Immunocytochemistry/ Immunofluorescence - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunocytochemistry/ Immunofluorescence - Anti-SNX8 antibody [OTI3C4] (ab119388)

      pCMV6-ENTRY SNX8 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for SNX8 using ab119388 at a 1/100 dilution in ICC/IF.

    • Flow Cytometry - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Flow Cytometry - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Flow Cytometry analysis of Jurkat (Human T cell leukemia cell line from peripheral blood) cells, labeling SNX8 with ab119388 at a 1/100 dilution (red) compared to a non-specific negative control antibody (blue).

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Paraffin-embedded human kidney tissue stained for SNX8 with ab119388 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Paraffin-embedded human liver tissue stained for SNX8 with ab119388 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Paraffin-embedded human bladder carcinoma tissue stained for SNX8 with ab119388 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SNX8 antibody [OTI3C4] (ab119388)

      Paraffin-embedded human tonsil tissue stained for SNX8 with ab119388 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

    • Western blot - Anti-SNX8 antibody [OTI3C4] (ab119388)
      Western blot - Anti-SNX8 antibody [OTI3C4] (ab119388)
      All lanes : Anti-SNX8 antibody [OTI3C4] (ab119388) at 1/200 dilution

      Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
      Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SNX8 cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 53 kDa

    References

    ab119388 has not yet been referenced specifically in any publications.

    Publishing research using ab119388? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab119388.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com