Overview

  • Product name

  • Description

    Rabbit polyclonal to SOCS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human SOCS3 aa 180-215 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIR


    Database link: O14543

  • Positive control

    • Rat brain and mouse embryo tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo (By similarity). Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST.
  • Tissue specificity

    Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Note=There is some evidence that SOCS3 may be a susceptibility gene for atopic dermatitis linked to 17q25. SOCS3 messenger RNA is significantly more highly expressed in skin from patients with atopic dermatitis than in skin from healthy controls. Furthermore, a genetic association between atopic dermatitis and a haplotype in the SOCS3 gene has been found in two independent groups of patients.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain

    The ESS and SH2 domains are required for JAK phosphotyrosine binding. Further interaction with the KIR domain is necessary for signal and kinase inhibition.
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues after stimulation by the cytokines, IL-2, EPO or IGF1.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATOD4 antibody
    • CIS 3 antibody
    • CIS-3 antibody
    • CIS3 antibody
    • Cish3 antibody
    • Cytokine induced SH2 protein 3 antibody
    • Cytokine-inducible SH2 protein 3 antibody
    • E2a Pbx1 target gene in fibroblasts 10 antibody
    • EF 10 antibody
    • MGC71791 antibody
    • SOCS 3 antibody
    • SOCS-3 antibody
    • Socs3 antibody
    • SOCS3_HUMAN antibody
    • SSI 3 antibody
    • SSI-3 antibody
    • SSI3 antibody
    • STAT induced STAT inhibitor 3 antibody
    • STAT-induced STAT inhibitor 3 antibody
    • Suppressor of cytokine signaling 3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling SOCS3 with ab216570 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryo tissue labeling SOCS3 with ab216570 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up