Overview

  • Product name

    Anti-SOCS3 antibody [OTI3D3]
    See all SOCS3 primary antibodies
  • Description

    Mouse monoclonal [OTI3D3] to SOCS3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant full length protein corresponding to Human SOCS3 aa 1-225. Produced in HEK-293T cells (NP_003946).
    Sequence:

    MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSA VTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGG SFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQ PSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGH LDSYEKVTQLPGPIREFLDQYDAPL


    Database link: O14543

  • Positive control

    • WB: pCMV6-ENTRY SOCS3 cDNA transfected HEK-293T cell lysate. IHC-P: Human colon adenocarcinoma and thyroid carcinoma tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY SOCS3 cDNA. Flow: HeLa and Jurkat cells.
  • General notes

    Clone OTI3D3 (formerly 3D3).

Properties

Applications

Our Abpromise guarantee covers the use of ab236519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 24 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

ICC/IF 1/100.
Flow Cyt 1/100.

Target

  • Function

    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo (By similarity). Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST.
  • Tissue specificity

    Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Note=There is some evidence that SOCS3 may be a susceptibility gene for atopic dermatitis linked to 17q25. SOCS3 messenger RNA is significantly more highly expressed in skin from patients with atopic dermatitis than in skin from healthy controls. Furthermore, a genetic association between atopic dermatitis and a haplotype in the SOCS3 gene has been found in two independent groups of patients.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain

    The ESS and SH2 domains are required for JAK phosphotyrosine binding. Further interaction with the KIR domain is necessary for signal and kinase inhibition.
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues after stimulation by the cytokines, IL-2, EPO or IGF1.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATOD4 antibody
    • CIS 3 antibody
    • CIS-3 antibody
    • CIS3 antibody
    • Cish3 antibody
    • Cytokine induced SH2 protein 3 antibody
    • Cytokine-inducible SH2 protein 3 antibody
    • E2a Pbx1 target gene in fibroblasts 10 antibody
    • EF 10 antibody
    • MGC71791 antibody
    • SOCS 3 antibody
    • SOCS-3 antibody
    • Socs3 antibody
    • SOCS3_HUMAN antibody
    • SSI 3 antibody
    • SSI-3 antibody
    • SSI3 antibody
    • STAT induced STAT inhibitor 3 antibody
    • STAT-induced STAT inhibitor 3 antibody
    • Suppressor of cytokine signaling 3 antibody
    see all

Images

  • All lanes : Anti-SOCS3 antibody [OTI3D3] (ab236519) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY SOCS3 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 24 kDa

  • Paraffin-embedded human colon adenocarcinoma tissue stained for SOCS3 using ab236519 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid carcinoma tissue stained for SOCS3 using ab236519 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY SOCS3 cDNA stained for SOCS3 (green) using ab236519 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cell line labeling SOCS3 with ab236519 at 1/100 dilution (red) compared to a non-specific negative control antibody (blue).

  • Flow cytometric analysis of Jurkat (Human T cell leukemia cell line from peripheral blood) cell line labeling SOCS3 with ab236519 at 1/100 dilution (red) compared to a non-specific negative control antibody (blue).

References

ab236519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up