Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)

Submit a review Submit a question

Overview

  • Product name

    Anti-Sodium Iodide Symporter antibody [FP5]
    See all Sodium Iodide Symporter primary antibodies

  • Description

    Mouse monoclonal [FP5] to Sodium Iodide Symporter

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WBmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Fusion protein corresponding to Human Sodium Iodide Symporter aa 468-643. NP_000444.1
    Sequence:

    PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRP ALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAPGLLWWDL ARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQ KELEGAGSWTPCVGHDGGRDQQETNL


    Database link: Q92911

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Mouse thyroid and trachea tissue. WB: Human thyroid lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab242007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000.
WB 1/1000. Predicted molecular weight: 68 kDa.

Target

  • Function

    Mediates iodide uptake in the thyroid gland.

  • Tissue specificity

    Expression is primarily in thyroid tissue, but also to a lower extent in mammary gland and ovary. Expression is reduced in tumors.

  • Involvement in disease

    Thyroid dyshormonogenesis 1

  • Sequence similarities

    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

  • Cellular localization

    Membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • Na(+)/I(-) cotransporter antibody
      • Na(+)/I(-) symporter antibody
      • Na+/I- cotransporter antibody
      • Na+/I-symporter antibody
      • NIS antibody
      • SC5A5_HUMAN antibody
      • Slc5a5 antibody
      • sodium iodide symporter antibody
      • Sodium-iodide symporter antibody
      • Sodium/iodide cotransporter antibody
      • Solute carrier family 5 (sodium iodide symporter) member 5 antibody
      • solute carrier family 5 (sodium/iodide cotransporter), member 5 antibody
      • Solute carrier family 5 member 5 antibody
      • TDH1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)

      Formalin-fixed, paraffin-embedded mouse thyroid tissue stained for Sodium Iodide Symporter with ab242007 at a 1/1000 dilution for 1 hr at RT in immunohistochemical analysis. Fixation: 10% Formalin Solution for 12-24 hours at RT.

      Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 µL for 5 minutes at RT.

    • Western blot - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Western blot - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Anti-Sodium Iodide Symporter antibody [FP5] (ab242007) at 1/1000 dilution + Human thyroid lysate

      Predicted band size: 68 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)

      Formalin-fixed, paraffin-embedded mouse trachea tissue stained for Sodium Iodide Symporter with ab242007 at a 1/1000 dilution for 1 hr at RT in immunohistochemical analysis. Fixation: 10% Formalin Solution for 12-24 hours at RT.

      Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 µL for 5 minutes at RT.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)

      Formalin-fixed, paraffin-embedded mouse thyroid tissue stained for Sodium Iodide Symporter with ab242007 at a 1/1000 dilution for 1 hr at RT in immunohistochemical analysis. Fixation: 10% Formalin Solution for 12-24 hours at RT.

      Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 µL for 5 minutes at RT.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Sodium Iodide Symporter antibody [FP5] (ab242007)

      Formalin-fixed, paraffin-embedded mouse thyroid tissue stained for Sodium Iodide Symporter with ab242007 at a 1/1000 dilution for 1 hr at RT in immunohistochemical analysis. Fixation: 10% Formalin Solution for 12-24 hours at RT.

      Secondary Antibody: HRP/DAB Detection System: Biotinylated Goat Anti-Mouse, Streptavidin Peroxidase, DAB Chromogen (brown) for 30 minutes at RT. Counterstain: Mayer Hematoxylin (purple/blue) nuclear stain at 250-500 µL for 5 minutes at RT.

    References

    ab242007 has not yet been referenced specifically in any publications.

    Publishing research using ab242007? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242007.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com